(data stored in ACNUC7421 zone)

EMBL: CP001349.PE116

CP001349.PE116       Location/Qualifiers
FT   CDS_pept        128363..129769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0121"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: met:M446_4754 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55168"
FT                   /db_xref="GOA:B8IUC3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55168.1"
FT                   /translation="MSNAETHPDSHRRQQSKKAAASGWIGSALEYYDFFIYATAASLIF
FT                   PQIFFPAANPMVAIVASLATYGVGYVSRPIGAFVLGHWGDTHGRKYVLILCMFLMGFST
FT                   IAVGLLPTYEQVGILAPILLVVLRLIQGFAVAGEISGASSMILEHAPFGRRGFYASFTL
FT                   QGVQAGQILAAAVFLPLAHYMPAEAFNTWGWRIPFLLSVVVIIAGFIIRREVEETPAFA
FT                   EEGAHGEIPRSPVVEAFRTSWADMLRVVCMALMNVIPVVATIFGAAYAVQAAYGIGFEK
FT                   DVYLWIPVLGNIVAVLVIPYVGNLSDRIGRRPPIIIGAIGSGLLSFGYLYAISIHNVPL
FT                   AIAMSLLMWGVVYQGYNAVYPSFYPELFPTRTRVSAMAISQNLGTAITAMLPALFAAVA
FT                   PPGSANIPLTVGAITLAITVLAALAALSARETYRIRMSDLGQPGAVPVGKTEYDRLREE
FT                   LASGGRLAGA"
     atgagcaacg cagaaacgca tccagattca cacagacggc agcaatccaa gaaggctgca        60
     gcgagcggct ggatcggatc tgcgctcgaa tactacgatt tcttcatcta cgcgacggca       120
     gcctcgctaa ttttcccgca aatcttcttt ccggcggcca atcccatggt ggccatcgtg       180
     gcgtcgctgg cgacctacgg cgtcggctat gtcagccggc cgatcggcgc cttcgtcctg       240
     gggcactggg gcgacaccca tggccgcaag tacgtgctga tcctgtgcat gttcctgatg       300
     ggcttctcga ccatcgcggt cggcctgctg ccgacctacg agcaggtcgg gatcctcgcg       360
     ccgatcctgc tcgtggtcct gcggctgatc cagggcttcg cggtggccgg cgagatctcg       420
     ggcgcgagct cgatgatcct ggagcacgcc ccgttcgggc ggcgcggctt ctacgcgagc       480
     ttcacgctgc agggcgtcca ggccggccag atccttgccg ccgccgtgtt ccttcccctc       540
     gcccactaca tgccggccga ggcgttcaac acctggggct ggcgcatccc gttcctgctc       600
     agcgtcgtgg tgatcatcgc gggcttcatc atccgccggg aggtcgagga gacgccggcc       660
     ttcgccgagg agggggcgca tggcgagatc ccgcgctcgc cggtcgtcga agccttccgg       720
     acgagctggg cggacatgct gcgggtcgtc tgcatggcgc tgatgaacgt catcccggtc       780
     gtcgccacca tcttcggcgc cgcctacgcc gtccaggccg cctacggcat cgggttcgag       840
     aaggacgtct atctgtggat cccggtgctc ggaaacatcg ttgcggtcct cgtcatcccg       900
     tatgtcggca acctgtcgga ccggatcggc cgccgaccgc cgatcatcat cggggcgatc       960
     ggctccgggc tgctctcgtt cggctatctc tacgccatca gcattcacaa cgtgccgctg      1020
     gcgatcgcga tgtcgctgct gatgtggggc gtggtgtatc agggctataa tgccgtctat      1080
     ccgagcttct accccgaact gttccccact cggacccggg tctcggcgat ggcgatctcg      1140
     cagaacctcg gaacggcgat caccgccatg ctgccggccc tgttcgccgc ggtggcgccc      1200
     cccggctcgg ccaacatccc gctgacggtc ggggcgatca ccctggcgat caccgtgctt      1260
     gccgcgctcg ccgccctttc ggcccgggag acctaccgca tccggatgag cgacctcgga      1320
     cagccgggtg ccgttccggt cggcaagacg gaatacgatc ggctgcggga ggaactcgca      1380
     tcgggcggac ggcttgccgg agcgtga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page