(data stored in ACNUC7421 zone)

EMBL: CP001349.PE117

CP001349.PE117       Location/Qualifiers
FT   CDS_pept        129870..131753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0122"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /EC_number="1.13.11.27"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: met:M446_4755 4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55169"
FT                   /db_xref="GOA:B8IUC4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL55169.1"
FT                   /translation="MRLAIATVCLSGTLGEKLEAIAAAGFTQVEIFENDLLSFSGTPRD
FT                   VRRMAEDLGLSVAVYQPFRDFEGMPEPQRAKVFARAERKFDTMQELGCDLLMVCSNVSP
FT                   DSLGGIDRAAADFRELGERAQARGFRVGYEALAWGRHVNDYRDAWEIVRRADHPAVGFV
FT                   LDSFHVLARGTDLSAIRSIPKEKIVLVQMADAPKLAMDYLSWSRHYRCFPGQGELPITA
FT                   FADALGATGFDGLMSLEIFSDRFRAGSARSVAVDGRRSLLVMLDDLRRRSSVPNLPVLP
FT                   PRAACEGVEFIEFAMDDEAAASFERMLGGLGFARTARHRSKSVTRWSQGGINLVVNTEK
FT                   EGFAHSFQVTHGASVCAVALKVDDAQAAVERAVALLDEPFRQAVAPGELDIPAVRGVGG
FT                   SLLYFVDRRSGLDRLWNVDFEPVATEPTGDAGLIAVDHLSQSMRHEEMLTWLLFYTGLF
FT                   DLAQQPVQDVVDPGGVVQSQAVEAPGGALRLVLNASQSRQTLSSRFLSEAFGGGVQHVA
FT                   LATDDIFATVEALRANGVDLLPIPENYYDDLEVRTDLSAETIARLRAGNILYDRDGQAE
FT                   FFQVYTRSVLEGGFFFEIVERRDYRGYGAINAPIRLAAQTHLAPHPALPTR"
     atgaggcttg ccatcgcgac cgtctgcctg agcggcacgc tcggcgagaa gctggaggcg        60
     atcgccgccg ccggcttcac gcaggtcgag atcttcgaga acgaccttct gtccttcagc       120
     ggcacgcctc gcgacgtgcg ccgcatggcc gaagacctcg gcctctcggt cgccgtctac       180
     cagccgttcc gcgatttcga gggcatgccc gagccgcagc gggccaaggt cttcgcccgc       240
     gccgagcgca agttcgacac catgcaggag ctcggctgcg accttttgat ggtctgctcc       300
     aacgtctcgc ccgacagcct cggcggcatc gaccgggcgg ccgcggattt ccgggagctc       360
     ggcgagcggg cgcaggcgcg cggcttccgc gtgggctacg aggccttggc ctgggggcgg       420
     cacgtcaatg attaccgcga tgcctgggag atcgtgcgcc gggccgacca tccggcggtc       480
     ggcttcgtgc tcgacagctt ccacgtgctc gcccgcggca ccgatctgag tgccatccgg       540
     tcgatcccga aggagaagat cgtcctggtg cagatggccg acgcgccgaa gctcgccatg       600
     gattacctgt cctggagccg ccactaccgc tgcttccccg gccagggaga gctgccgatc       660
     accgccttcg cggacgcgct gggggcgacg ggcttcgacg gcctgatgtc gctcgagatc       720
     ttcagcgacc ggttccgggc cggctcggcg cgcagcgtcg cggtcgacgg ccgccggtcc       780
     ctcctcgtca tgctcgacga cctgcgccgc cgctcatccg tgccgaatct cccggtgctg       840
     ccgccgcgcg cggcttgcga gggcgtcgag ttcatcgagt tcgcgatgga cgatgaggcc       900
     gccgcctcct tcgagcgcat gctcggcggg ctcggcttcg cccggaccgc ccgccaccgc       960
     tcgaaatccg tgacgcgctg gagccagggc ggcatcaacc tcgtggtcaa cactgagaag      1020
     gagggattcg ctcattcctt ccaggtcacg catggcgcct cggtctgcgc cgtcgccctg      1080
     aaggtcgacg atgcgcaggc ggcggtggag cgggccgtcg cgctcctcga cgagccgttc      1140
     cggcaggcgg tcgcaccggg cgagctcgac atcccggcgg tgcgtggggt cgggggcagc      1200
     ctcctctact tcgtcgaccg ccgcagcggc ctcgaccggc tgtggaacgt cgatttcgag      1260
     ccggtcgcaa cggaaccgac cggggatgcg ggcctcatcg cggtcgatca cctctcgcag      1320
     agcatgcgcc acgaggagat gctgacctgg ctcctgttct acaccgggct gttcgacctc      1380
     gcgcagcagc cggtgcagga cgtggtggat cccggcggcg tggtgcagag ccaggccgtc      1440
     gaggcgcccg gcggggcgtt gcgcctcgtc ctcaacgcct cgcagagccg ccagacgctg      1500
     tcgtcgcgct tcctctcgga agccttcggc ggaggcgtgc agcatgtggc gctcgccacc      1560
     gacgacatct tcgcgaccgt cgaggcgctg cgggcgaacg gtgtcgacct cctgccgatc      1620
     ccggagaact actacgacga tctcgaagtc cggaccgacc tgagcgcgga gacgatcgcg      1680
     cggctgcgcg ccggcaacat cctctacgac cgcgacggac aggccgagtt cttccaggtc      1740
     tatacgcgca gcgtgctcga gggcgggttc ttcttcgaga tcgtcgaacg gcgtgactat      1800
     cgcggctacg gggccatcaa cgcgccgatc cgtcttgcgg cgcagaccca tctcgcgcca      1860
     catccggcgc tccccacccg ttag                                             1884
//

If you have problems or comments...

PBIL Back to PBIL home page