(data stored in ACNUC7421 zone)

EMBL: CP001349.PE118

CP001349.PE118       Location/Qualifiers
FT   CDS_pept        131777..132202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0123"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase class II; KEGG: met:M446_4756
FT                   3-dehydroquinate dehydratase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55170"
FT                   /db_xref="GOA:B8IUC5"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC5"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ACL55170.1"
FT                   /translation="MRDIHVLNGPNLNLLGIREPGIYGALTLADIERRLRDRAGARAAL
FT                   TFRQSNHEGDLVTWVHEAGAAGAGVILNAGAYTHTSVALRDAISGAKAEVIEVHLSNVH
FT                   ARESFRHHSYIAPVARGVIAGFGPLSYDLALEALLAA"
     atgcgcgaca tccacgtcct caacggcccg aacctgaacc tcctcggcat ccgggagccc        60
     ggcatctacg gcgcgctcac cctggccgat atcgagcggc gcctgcgcga ccgggccggc       120
     gcgcgcgccg ctctcacctt ccgccagtcg aaccacgagg gcgatctcgt cacctgggtg       180
     cacgaggcgg gcgccgcggg ggcgggcgtg atcctgaacg caggcgccta cacgcatacg       240
     tcggtggcgc tgcgcgacgc catatcgggt gccaaggcgg aggtcatcga ggtccacctc       300
     tcgaacgtcc atgcccgcga gagcttccgg caccactcct atatcgcgcc ggtggcgcgc       360
     ggcgtgatcg cgggattcgg gcccctctcc tacgatctcg ccctcgaagc gctgctcgcc       420
     gcctag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page