(data stored in ACNUC7421 zone)

EMBL: CP001349.PE119

CP001349.PE119       Location/Qualifiers
FT   CDS_pept        complement(132491..132904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0124"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   met:M446_6298 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55171"
FT                   /db_xref="GOA:B8IUC6"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC6"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL55171.1"
FT                   /translation="MASDLTLITADIVSLYIMNNSIGADDLPNLIRSVHSALEDIDRVE
FT                   KPQPATLEPPVPIEQTVTPDYIVSLEDGKPYKTLGRHLHTKGLTPDQYRRKWGLPPDYP
FT                   MIAPSYAAHRAELAKRGSLGRKLGSRAEGDDAE"
     atggcctccg acctcacgtt gatcacggcc gatatcgtgt ccctctacat catgaacaat        60
     agtattgggg ctgatgatct cccgaatctg attagatcgg ttcattcggc gctcgaagac       120
     atcgaccggg tggagaaacc gcagcctgcg acgctcgaac cgccggtgcc gatcgagcag       180
     accgtgacgc ccgactacat cgtcagcctg gaagacggaa aaccctataa gaccctgggc       240
     cgtcatctgc acacgaaggg tctcacgccc gatcaataca ggcggaagtg gggtctgccg       300
     cccgattatc cgatgatcgc gccgtcctat gcggcgcacc gggccgaact ggccaagcgc       360
     ggaagcctcg gccggaagct cggctcccgc gccgaaggcg acgacgccga gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page