(data stored in ACNUC7421 zone)

EMBL: CP001349.PE120

CP001349.PE120       Location/Qualifiers
FT   CDS_pept        complement(133456..134328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0125"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; KEGG: met:M446_4766
FT                   2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55172"
FT                   /db_xref="GOA:B8IUC7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC7"
FT                   /inference="protein motif:TFAM:TIGR01362"
FT                   /protein_id="ACL55172.1"
FT                   /translation="MPFESPMMSTDSPSPGTVVAVGDVRFGNHLPLSLIAGPCALESRA
FT                   HALEVAAALKEMTAPLGLGLVFKSSFDKANRTSAGSARGLGLAEALPIFAEIRERLRLP
FT                   VLTDVHEAGQCAVAAEAVDILQIPAFLCRQTDLLLAAAATGRAVNVKKGQFLAPWDMAH
FT                   VAAKVTAAGNPNVIVTERGASFGYNTLVSDMRALPIMARVTNGAPVVFDATHSVQQPGG
FT                   QGATSGGQREFVPVLARAAVAVGVAGVFIETHPDPDRAPSDGPNMVPLRAMPALLGDLV
FT                   AFDRLAKAL"
     atgcctttcg aaagcccgat gatgtcgacc gattccccgt cccctggcac cgtcgtcgcg        60
     gtcggcgatg tgcgcttcgg caatcatctg ccgctgagcc tgatcgccgg accctgcgcg       120
     ctggagagcc gcgcccatgc cctggaagtg gctgcggcgc tcaaggagat gaccgcaccc       180
     ctcggcctcg gcctcgtgtt caagtcatcc ttcgacaagg ccaaccgcac ctcggccgga       240
     tcggcccgcg gcctcggcct cgccgaggcc ctgccgatct tcgccgagat ccgcgagcgc       300
     ctgcggcttc ccgtgctcac ggatgtgcac gaggccggcc aatgcgcggt cgcggcggag       360
     gccgtcgaca tcctgcagat cccggccttc ctgtgccgcc agaccgacct gctgctcgcc       420
     gccgccgcga ccgggcgggc cgtgaacgtc aagaaggggc agttcctggc gccctgggac       480
     atggcgcatg tcgccgccaa ggtcacggcc gcgggcaacc ccaatgtgat cgtcaccgag       540
     cgcggcgcgt ccttcggcta caacaccctc gtctcggaca tgcgggccct gccaatcatg       600
     gcgcgggtga cgaacggggc tccggtggtg ttcgacgcca cgcactcggt ccagcagccg       660
     ggcgggcagg gcgccacgtc gggcgggcag cgggaattcg ttccggtgct ggcgcgggcg       720
     gcggtggcgg tgggtgtggc gggcgtcttc atcgagacgc atcccgatcc ggaccgcgcg       780
     ccgtcggacg gacccaacat ggtgccgctg cgggccatgc cggcgctgct cggcgacctc       840
     gtcgccttcg accgcctcgc gaaggcgctc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page