(data stored in ACNUC7421 zone)

EMBL: CP001349.PE121

CP001349.PE121       Location/Qualifiers
FT   CDS_pept        complement(134383..134919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0126"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   met:M446_4767 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55173"
FT                   /db_xref="GOA:B8IUC8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACL55173.1"
FT                   /translation="MRGPVTDPMIRALSGEEALARSEALAAILVDCVAGGASVSFMAPL
FT                   PQARAVAYWRDVAESVGRGERSLIVAEESDGTPVGTVQIVLAQPENQPHRADLSKVLVL
FT                   RRARRRGIGAGLMRAAEDAARRAGKTLLVLDTASPEAERLYERAGWSRVGVIPGYALLP
FT                   DGRPCDTVYFFKALA"
     atgagaggtc ccgtgaccga tccgatgatc cgcgcgctct ccggtgagga ggctctggcg        60
     cgcagcgagg cgcttgcggc gattctggtc gactgcgtcg cgggcggagc ctcggtgagc       120
     ttcatggcgc ccctgccgca ggccagggcc gtcgcctatt ggcgggacgt ggccgagagc       180
     gtcgggcgcg gggagcgcag cctgatcgtg gccgaggaat ctgacggcac gccggtcggc       240
     accgtccaga tcgtcctggc gcagcccgag aaccagccgc accgggccga cctgtcgaag       300
     gtgctggtgc tgaggcgggc gcgccgccgc gggatcggcg ccggcctgat gcgggctgcc       360
     gaggatgccg cgcgccgtgc tggcaagacg ctcctcgtgc tcgacaccgc cagccccgag       420
     gcggagcggc tctacgagcg ggcgggctgg agccgggtcg gcgtcatccc cggctacgcg       480
     ctcctgcccg acgggcgccc ctgcgatacg gtctatttct tcaaggccct ggcgtag          537
//

If you have problems or comments...

PBIL Back to PBIL home page