(data stored in ACNUC7421 zone)

EMBL: CP001349.PE122

CP001349.PE122       Location/Qualifiers
FT   CDS_pept        complement(134923..135504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0127"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: met:M446_4768 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55174"
FT                   /db_xref="GOA:B8IUC9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACL55174.1"
FT                   /translation="MDEPRSDLDARLAARLRGLRTAQGLTLEALAQRCGVSRSMISLVE
FT                   RAESSPTATVLERLSAGLGVSLAALFSPEHREDASPLSRRADQRCWRDPGTGYRRRNLS
FT                   PPGFSSPLELVEVELPPGSTVAYDSIRVPPLEQQVWVLDGTVVVTLGEAVHRLAAGDCL
FT                   AMRVDRPVAFHNPADHPARTLVAVSTGARA"
     atggatgaac cgcgatccga tctcgatgca aggcttgccg caaggctccg gggcttgcgc        60
     actgcccagg gtctgaccct ggaggcgctc gcgcagcgct gtggggtgag ccgatcgatg       120
     atctcgctgg tggagcgcgc ggagagcagc ccgaccgcga ctgtgctcga acggctgtcg       180
     gcggggctcg gggtatcgct cgcggccctg ttctcgcccg agcaccggga ggatgcctcc       240
     ccgctgagcc ggcgcgcgga tcagcgctgc tggcgcgatc cggggacggg ctatcggcgc       300
     cgcaacctct cgccgccggg cttttcctcg cccctcgaac tcgtggaggt ggagctgcct       360
     ccgggttcga cggtcgccta cgacagcatc cgcgtcccgc ccctggagca gcaggtctgg       420
     gtgctcgacg gcacggtcgt ggtgacgctg ggagaggcgg ttcatcggct cgcggccggc       480
     gactgcctcg ccatgcgcgt cgaccggccg gtcgccttcc acaatcccgc cgatcaccct       540
     gcccgcaccc tcgtggccgt ctccacgggc gcgcgggcct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page