(data stored in ACNUC7421 zone)

EMBL: CP001349.PE123

CP001349.PE123       Location/Qualifiers
FT   CDS_pept        135625..136527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55175"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD0"
FT                   /inference="similar to AA sequence:KEGG:M446_4769"
FT                   /protein_id="ACL55175.1"
FT                   /translation="MIPSGYSRTRAVAGGFLMSCLLAGPVAAIAHEAGQAEAEIDSEHL
FT                   FGFTEGSDIGVPGERELEQETTARIGRLRAGVVRAIDPTLALKLPLSSDFRIAPGLSFS
FT                   HFDLAATPGLPVRGESGFNGGFVETRLRLLDRRTAPIGLTLSVVPSIGTIDGGSGLAAR
FT                   AYGVEAALLADREIIPGLLVGALNLNLGLARAEFGGGETVRSSGLEVSGALAYRVRPWL
FT                   FLGGELRYARAYEGLGLDRFAGAALYLGPTLYAALSEGAWMSFTWGVQVAGGAAADPRP
FT                   LDLTNFDRHQLRLRVGLTF"
     atgataccct caggctattc ccgcactcgc gccgtcgcag gcggattcct gatgtcctgt        60
     ctcctcgccg ggccggtagc ggcgatcgcc catgaggccg ggcaggccga agcggagatc       120
     gacagcgagc atctgttcgg gttcacggaa gggtcggata ttggcgtgcc gggcgagcgc       180
     gagctggagc aggagaccac cgcccggatc gggcggttgc gggcgggcgt ggtccgcgcc       240
     atcgacccga cgctcgcgct gaagctgccg ctcagttcgg atttccggat cgcgcccggg       300
     ctgtccttct cgcatttcga cctggccgcg acgccgggcc tgcccgtgcg cggggaaagc       360
     ggattcaatg gcggcttcgt ggagacccgt ctgcgcctgc tggaccggcg cacggcgccc       420
     atcggcctga cgctgagcgt cgttccgagc atcgggacga tcgacggcgg atccggtctt       480
     gcggcccgcg cctacggggt ggaggcggcc cttctcgccg atcgcgagat catcccgggc       540
     ctgctcgtcg gcgcactcaa tctcaacctg ggcctggccc gtgcagagtt cggcggcggc       600
     gagacggtgc gcagctccgg cctcgaagtg tccggcgccc tcgcctaccg ggtgcggccg       660
     tggctcttcc tcggcggcga gctgcgctac gcgcgcgcct atgaggggct cggcctcgac       720
     cgtttcgcgg gcgcggccct ctatctcggc ccgacgctct acgccgcgct ctccgagggt       780
     gcctggatgt cgttcacctg gggcgtgcag gtggccggcg gcgcggcggc ggatccgcgg       840
     cccctcgacc tgacgaattt cgaccgccac cagctgcggc tgcgggtcgg tctcacgttc       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page