(data stored in ACNUC7421 zone)

EMBL: CP001349.PE124

CP001349.PE124       Location/Qualifiers
FT   CDS_pept        136917..138092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0129"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bra:BRADO5530 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55176"
FT                   /db_xref="GOA:B8ILL4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B8ILL4"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL55176.1"
FT                   /translation="MRERVVPWQEVSVIDNRAEFVGLAQQEAANVAALCRRFGISRKTG
FT                   YKWLGRARSGAGLDDRSRRPHASPARTSPEMEEAVLELRTAHPSWGGRKLRRRLQDQGQ
FT                   EVVPAASTITAVLARHARLGQPDAPSIPFTRFEHPRPNALWQMDFKGHFAHAGGRCHPL
FT                   TVLDDHSRYALCLAACADEVTATVQGQLSATFRRYGLPERINLDNGSPWGNGPGQRYTP
FT                   LTVWLLRLGIHISHSRPYHPQTNGKDERFHRTLKRDVLHGAFYASLAACQRAFDRFRLI
FT                   YNSERPHEALGLAVPASRYQISRRAYPAELPAIEYDPTDQVRRVQRDGWISVRGQLVRV
FT                   PKAFVGQPLALRPTQTDGRVDLVFITHRVGQIDLTQPTLRVQPVTHVSEHL"
     atgcgggagc gtgtcgtgcc ttggcaagag gtgtcagtca tagacaaccg cgccgagttc        60
     gtgggtctgg cccagcagga ggcggcgaac gtggcggcgc tgtgccgccg cttcgggatc       120
     agccgcaaga ctggctacaa gtggctgggc cgggcgcgga gtggcgcggg cttggacgac       180
     cgctcgcggc gcccgcacgc cagcccggcc cgcacgtccc ccgagatgga ggaggcggtg       240
     ctggaactgc gcacggctca tccgagttgg ggtgggcgca agctgcgccg acggctgcag       300
     gatcagggcc aggaggtggt cccggccgcc tcgacgatca ccgccgtgct ggcgcgccac       360
     gcccggctgg gccaacccga tgcccccagc atcccgttca cccgcttcga gcacccccgg       420
     cccaacgctc tctggcagat ggacttcaag ggccacttcg cccatgccgg cggccgctgc       480
     caccctctca ccgtgctgga cgaccacagc cgctacgcgc tctgcctggc ggcctgtgcc       540
     gacgaggtca ccgcgaccgt gcaggggcag ctgagtgcca cgttccggcg ctacggcctg       600
     cccgagcgga tcaacctgga caacggcagc ccctggggca acggaccggg ccagcgctac       660
     acgcctctca ccgtgtggct gctgcggctg ggcatccaca tcagccacag ccggccctac       720
     catccgcaga ccaacggcaa ggacgagcgc ttccatcgca ccctcaagcg cgacgtgctg       780
     catggcgcgt tctacgccag cctggcggcc tgccagcggg cgttcgatcg cttccggctg       840
     atctacaaca gcgagcgccc gcacgaggcc ttaggcttgg cggtgccggc cagccgctac       900
     cagatcagcc ggcgcgctta tccggccgag ctgccggcga tcgagtacga tccgaccgat       960
     caggtgcggc gcgtgcagcg ggacggctgg atcagcgtgc gcggccagct cgtgcgagtg      1020
     cccaaggcgt tcgtcggcca gccgctggcc ctgcggccca ctcagaccga tggtcgggtc      1080
     gaccttgtgt tcatcaccca cagggtgggg cagatcgacc tgacacagcc aacactcagg      1140
     gtgcaacctg tcacccatgt ctccgaacac ctgtaa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page