(data stored in ACNUC7421 zone)

EMBL: CP001349.PE125

CP001349.PE125       Location/Qualifiers
FT   CDS_pept        complement(139557..141449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0131"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: met:M446_4771
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55177"
FT                   /db_xref="GOA:B8IUD2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL55177.1"
FT                   /translation="MPEETRPGPVPASRTTLRGRVRKSATPTEPRRRQALAWAAALAIV
FT                   VLAAWSGGRIAERAALADLRRSALSGLTLQVAALRAEMQKQASLPLALAADPEIARVVA
FT                   AQAEPGLADRVSFRLSEIAGATGAAVIYVIRADGLTAAASNAGTATSFVGNDYTFRPYF
FT                   REALAEGAGSQFALGTVSGRPGLYLSRRIAGGSGVVVVKVEFDGVEAAWRGSGAQVFAT
FT                   DPRGIVLVSSEPAWRFRALGPVEAAERQRIRERLDFGNADLSPLPLHPVGESGLMRLGG
FT                   AATPARLVLPLDAAVPDTTWRLHTLTPVGAAVRRERLQTQVLAGVVAGAACAGIAVHLG
FT                   RRRRIRSRLAEEASRREELERRVQERTRALTDANAQLRAEMAERQRAEAERERLGRELA
FT                   QAGRLAALGQFAASMAHEINQPLAAIRSYADNAAILIRRGRIEDASENFSAIGRLTERI
FT                   AGLTRQLKGFARRASGRREPVSLAGVLRNALEVVEARAATGGVTLAVDRPEPDLIVLGD
FT                   GARLEQVVVNLLQNALDAVAGRPDPRVTVRAAALGDRALLEVGDNGPGIPDSVRAQVFD
FT                   PFFTTKAEGLGLGLAISRGIVEECGGTLAVATGEAGGAVFRVDLARTQAAEEAA"
     atgccggagg agacgcggcc cggccccgtt ccggcctccc gcacgacgct gcggggccgc        60
     gtgcggaaat ccgcaacgcc gacggagccc cgccggcggc aggccctggc ctgggctgcg       120
     gccctggcga tcgtcgtgct ggcggcctgg agcggcgggc gcattgcgga gcgggcggcg       180
     ctggcggatc tgcgtcgctc ggccttgtcc ggtctcaccc tccaggtggc cgcgctgcgg       240
     gccgagatgc agaaacaggc gtcgctcccg ctcgcgctcg ccgccgatcc ggagatcgcg       300
     cgggtcgtcg cggcgcaggc ggagccgggc ctcgcggaca gggtgagctt ccgtctctcc       360
     gagatcgccg gcgcgacggg ggccgcggtc atctacgtga tccgggcgga tggcctgacg       420
     gccgccgcga gcaatgcggg cacggcgacg agcttcgtcg gcaacgacta taccttccgg       480
     ccctatttcc gggaggcgct ggcggagggc gccggatcgc agttcgccct cggcacggtg       540
     agcgggcgcc ccggcctcta tctgtcgcga cggatcgcgg gcgggagcgg cgtcgtggtg       600
     gtcaaggtcg agttcgacgg cgtggaggcc gcgtggcggg gcagcggcgc gcaggtcttc       660
     gccaccgacc cccgcggcat cgtcctggtg tcgagcgagc cggcatggcg gttccgcgcc       720
     ctcggcccgg tcgaggccgc cgagcgccag cggatccgcg agcgcctcga cttcggcaat       780
     gcggatctga gcccgctgcc cctgcatccc gttggagaga gcggcctgat gcggctcggc       840
     ggggctgcga cgcccgcgcg cctcgtcctg cccctcgacg ctgcggtgcc ggacaccacc       900
     tggcggctcc atacattgac cccggtcggc gcggcggtgc ggcgcgagcg tctccagacc       960
     caggtgctcg cgggcgtggt ggcaggagcg gcctgtgcgg gaatcgccgt gcatctgggc      1020
     cgccgccgcc gcatccgctc gcgcctcgcc gaggaggcga gccggcgcga ggagctggag      1080
     cgccgtgtcc aggaacgcac ccgcgccctc accgacgcga atgcgcagct cagggccgag      1140
     atggcggagc gccagcgggc tgaggccgag cgcgagcggc tcggccgcga gctcgcccag      1200
     gccggccgcc tcgcggcgct cggccagttc gccgccagca tggcgcacga gatcaaccag      1260
     ccgctcgccg ccatccgctc ctacgcggac aatgccgcga tcctgatccg ccgcggccgc      1320
     atcgaggatg cgagcgagaa tttttccgcc atcggccgcc tcaccgagcg catcgccggc      1380
     ctcacgcgcc agctcaaggg cttcgcccgg cgggcctcgg gccggcgcga gccggtgtcg      1440
     ctggccggcg tcctgcgcaa cgcccttgag gtggtggagg cccgcgccgc gacgggcggc      1500
     gtcaccctcg cggtcgaccg gcccgagccg gacctgatcg tgctcgggga tggggcgcgc      1560
     ctggaacagg tggtggtgaa ccttttgcag aacgcgctcg atgccgtggc gggccggccc      1620
     gacccgcgcg tgacggtgcg ggcggccgcc ctcggcgacc gggcgctgct ggaggtcggc      1680
     gacaacgggc cggggatccc ggattccgtg cgggcgcagg tcttcgaccc gttcttcacc      1740
     acgaaggccg aggggctggg gctcggcctc gccatctcgc ggggcatcgt cgaggaatgc      1800
     ggcggcacgc tcgcggtcgc cacgggcgag gcgggcggcg ctgtgttccg cgtcgacctc      1860
     gcccgcacgc aagcggcgga ggaagcggca tga                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page