(data stored in ACNUC7421 zone)

EMBL: CP001349.PE126

CP001349.PE126       Location/Qualifiers
FT   CDS_pept        141666..143015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0132"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   met:M446_4772 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55178"
FT                   /db_xref="GOA:B8IUD3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD3"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACL55178.1"
FT                   /translation="MAVTVPSPLTAPQAPPAPKPLYKTLYFQVLVAVAIGILLGHFYPQ
FT                   LGAEMKPLGDAFIKLVKMIIAPVIFLTVVSGIAGMTNLEKVGRVGAKALIYFITFSTLA
FT                   LIVGLVVANVLQPGHGLHIDPKSLDPKAVATYAGKAKEQSIVEFLMHIIPSTAVGAFAG
FT                   GEILQVLFFSVLFGFGLAFMGDRGKPVLDLIKVTAEAIFGVVHIIMKVAPIGAFGAMAF
FT                   TIGKYGVSSLANLAYLVFAFYLTSAIFVLVVLGPVARYNGFSVIKLVRYIKEELLLVLG
FT                   TSSSESALPTLIDKMERAGCSRPVVGLVVPTGYSFNLDGTNIYMTMAALFIAQATDTPL
FT                   SLGEQALLLLVAMLSSKGAAGVTGSGFITLAATLAVVPSVPVVGMALILGIDRFMSECR
FT                   ALTNFIGNAVACIVVARWEGEVDEARLAAALNGNPLPLAEDVPAILQPAE"
     atggccgtga ccgtcccatc gcccctgact gctccgcagg cgccgccggc gcccaagccc        60
     ctctacaaga ccctctactt ccaggttctc gtcgcggttg cgatcggcat cctgctcggt       120
     cacttctacc cgcagctcgg cgccgagatg aagccgctcg gcgacgcctt catcaagctc       180
     gtcaagatga tcatcgcgcc ggtgatcttc ctcacggtcg tctccggcat cgccggcatg       240
     acgaatctgg agaaggtcgg gcgcgtgggc gccaaggcgc tgatctactt catcaccttc       300
     tcgacgctgg cgctgatcgt cgggctggtg gtggccaatg tgctgcagcc gggccacggc       360
     ctgcacatcg accccaaatc cctcgacccc aaggccgtcg ccacctatgc gggcaaggcc       420
     aaggagcaga gcatcgtcga gttcctgatg cacatcatcc cctcgacggc ggtcggcgcc       480
     ttcgcggggg gcgagatcct tcaggtgctg ttcttctcgg tgctgttcgg cttcggcctc       540
     gccttcatgg gtgaccgcgg caagccggta ctcgatctca tcaaggtcac ggccgaggcg       600
     atcttcggcg tcgtccacat catcatgaag gtggccccga tcggcgcctt cggcgcgatg       660
     gccttcacca tcggcaagta cggcgtctcg tcgctcgcca acctcgccta tctggtcttc       720
     gccttctatc tcacctcggc gatcttcgtc ctcgtcgtgc tcgggcccgt cgcccgctac       780
     aacggcttct cggtgatcaa gctggtgcgc tacatcaagg aggaactcct cctggtgctc       840
     ggcacctcct cgtcggaatc ggcgctgccc acgctcatcg acaagatgga gcgggcgggc       900
     tgctcgcggc cggtggtcgg cctcgtggtg ccgaccggct attccttcaa cctcgacggc       960
     accaacatct acatgaccat ggcggccctg ttcatcgccc aggcgaccga cacgccgctg      1020
     tcgctcggcg agcaggctct gctcctcctc gtggcgatgc tgtcctcgaa gggcgcggcg      1080
     ggcgtgaccg ggtcgggctt catcacgctc gcggcgacgc tggcggtggt cccctcggtg      1140
     ccggtcgtcg gcatggcgct gatcctcggc atcgaccgct tcatgtccga gtgccgggcg      1200
     ctcaccaact tcatcggcaa cgcggtggcc tgcatcgtcg tcgcccgctg ggagggcgag      1260
     gtcgacgagg cccgcctcgc cgcagccctc aacggcaacc cgctgccgct ggcggaggac      1320
     gtccccgcca tcctgcagcc ggcggagtga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page