(data stored in ACNUC7421 zone)

EMBL: CP001349.PE127

CP001349.PE127       Location/Qualifiers
FT   CDS_pept        complement(143121..143663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0133"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: met:M446_2672
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55179"
FT                   /db_xref="GOA:B8IUD4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD4"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACL55179.1"
FT                   /translation="MILLRHGQSVFNLHYGATGEDPDIPDAPLTPLGHRQAEAAAEALA
FT                   GEGIRRILCSPYTRALQTAAPVAARLGLPVLVTCAVRERFAASCDIGTGRTALASAWPQ
FT                   LDFGAVAEVWWPDAEEPHDLFHARTTAFRSEMAADPDWAHTLVVCHWGVIMALTGRSLD
FT                   NGAWIRLERDERITLGE"
     atgatccttc tccggcacgg acagagcgtg ttcaacctgc attacggcgc caccggcgag        60
     gatccggaca tcccggacgc gccgctcacg cccctggggc accggcaggc cgaggccgcc       120
     gcggaggctc tcgccggcga gggaatccga cggatcctct gctcgcccta tacgcgcgcc       180
     ctgcagacgg cggcgcccgt ggcggcgcgg ctcggcctcc cggtcctggt gacgtgtgcg       240
     gtgcgcgagc ggttcgcggc gagctgcgac atcggcacgg gacggaccgc cctcgcttcg       300
     gcgtggccgc agctcgattt cggcgccgtc gcggaggtct ggtggccgga cgcggaggag       360
     ccgcacgatc tcttccatgc gcgcacgacg gcattccgca gcgagatggc ggccgatccc       420
     gactgggccc acaccctcgt cgtctgccat tggggggtca tcatggccct cacgggccgg       480
     agtctcgaca acggagcctg gatccgcctg gagcgcgacg agaggatcac gctcggggag       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page