(data stored in ACNUC7421 zone)

EMBL: CP001349.PE128

CP001349.PE128       Location/Qualifiers
FT   CDS_pept        complement(143660..145426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55180"
FT                   /db_xref="GOA:B8IUD5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD5"
FT                   /inference="similar to AA sequence:KEGG:M446_2673"
FT                   /protein_id="ACL55180.1"
FT                   /translation="MLVYGDTARTGDPPQWLARVAALCRQAAALPPGIERHGRLVAALI
FT                   EVGELGQGIADAIFVQHGADTPSAGSEAVTALLMALARAVRRSWSSGFTSCEAIPPGLL
FT                   EAVERTLLPTSITGKRAEGFAFYALYPEAYAAAAETSGLGGDTRVVGIRSIGLPLAAMT
FT                   ASALGASPPLTIRPVGHPFERRLSLSRAMDDALCGDLRGDIAIVDEGPGLSGSSFGAVA
FT                   DHLEARGVAPARLVFFPGHTGEPGPMARARHRARWATTRRIAIGFDELVLDAREPVHRL
FT                   DSWVASLIGPLDGPLDDISGGAWRSLQAAPFDAWPPVHAQQERRKFLARADGATWLVKF
FT                   AGLGAAGDEALALARQLQAAGFTPPVAGLVHGFLVERWLAEARPLTSGAIDPLRLAEAV
FT                   GHYLAFRARTLPAEPGRGAALSDLVAMARHNTAEALGHDTARLFDPWDERRVAGLAERV
FT                   RPVLIDGRLQPWEWLLLPDGSLRKADALEHHAGHDLVGCQDIAWDVAGAAIELDLPPDA
FT                   QECLASTMVREGARWPDPDLLALLALCYLAFRLGASSLAAESGAAPDEAQRLRRAASAY
FT                   GARLGRLLRDGG"
     atgctcgtct acggggacac ggcccggacc ggcgatccgc cgcaatggct cgcccgggtc        60
     gccgcgctct gccggcaggc cgcggcgctc ccgccgggga tcgagcgcca cgggcggctc       120
     gtcgcagccc tgatcgaggt cggcgaactg ggccagggca tcgccgacgc aatcttcgta       180
     cagcacggcg ccgatacgcc ctcggccggg tcggaggccg tgacggccct gctgatggcg       240
     cttgcccgcg ccgtccggcg ctcctggagc agcggcttca cctcctgcga ggcgataccg       300
     cccgggctgc ttgaggcggt ggagcggacg ctgcttccga cgagcatcac gggaaagcgc       360
     gccgagggct tcgccttcta cgccctgtat ccggaagcct atgcggcggc ggccgagacc       420
     tccggattgg ggggcgacac ccgcgtcgtc gggatccgca gcatcggcct gccgctcgcc       480
     gccatgacgg cctcggccct tggcgcctcg ccgcccctga cgattcgacc cgtcggccat       540
     ccgttcgaga ggcggctctc gctgagccgc gcgatggacg acgcgctgtg cggggatctc       600
     cgcggcgaca tcgccatcgt cgacgagggg ccgggcctgt ccggcagttc cttcggcgcg       660
     gtcgccgatc acctggaggc gcgcggcgtc gcgccggccc ggctcgtctt cttccccggg       720
     cacaccggcg agccggggcc gatggcccgg gcgcgccacc gcgcccgctg ggcgacgacc       780
     cgccggatcg cgatcggctt cgacgaactc gtcctggatg cgcgcgaacc tgtgcaccgg       840
     ctcgacagct gggtcgcatc cctgatcgga cccctcgacg ggccgctcga cgacatctcg       900
     ggtggcgcct ggcggagcct tcaggccgcg ccgttcgatg catggcctcc ggtccatgcg       960
     cagcaggagc ggcgcaagtt cctggcgcgg gcggatggag cgacctggct cgtcaagttc      1020
     gccgggctgg gcgctgccgg ggacgaggcc ctggccctcg cgcggcagct gcaggcggcc      1080
     ggcttcacgc cgcccgtggc gggcctcgtg catggcttcc tggtggagcg ctggctcgcc      1140
     gaggcgcgtc cgctcacctc aggcgcgatc gatcctctac ggctcgccga ggcggtcggg      1200
     cactacctcg ccttccgggc ccgcactctt ccggcggagc ccgggcgcgg cgccgccctg      1260
     tccgacctcg tcgcgatggc ccgccacaac accgccgagg cgctcggaca cgataccgca      1320
     cgacttttcg atccttggga cgagcggcgg gtcgccggcc tcgccgagcg ggtccggccc      1380
     gtcctgatcg acgggcgtct ccagccctgg gaatggctcc tgctgccgga cgggagcctg      1440
     cgcaaggcgg atgccctcga gcatcatgcc ggccacgacc tcgtcggctg ccaggacatc      1500
     gcctgggacg tggccggggc cgccatcgaa ctcgatctgc cgccggacgc gcaggagtgc      1560
     ctggccagca caatggttcg ggagggcgcc cgatggcccg atcccgacct cctcgccctc      1620
     ctggccctgt gctacctcgc cttccggctc ggcgcgtcga gcctcgccgc ggagagcgga      1680
     gccgcccccg atgaggcgca gcggctccgg cgcgcggctt cggcctacgg cgcccgcctc      1740
     ggccgacttc tgagggatgg tggatga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page