(data stored in ACNUC7421 zone)

EMBL: CP001349.PE129

CP001349.PE129       Location/Qualifiers
FT   CDS_pept        145840..147588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0135"
FT                   /product="ankyrin"
FT                   /note="KEGG: met:M446_2674 ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55181"
FT                   /db_xref="GOA:B8IUD6"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD6"
FT                   /inference="similar to AA sequence:KEGG:M446_2674"
FT                   /protein_id="ACL55181.1"
FT                   /translation="MNEMVSKDRLAAVRPQAVGARPKGDRLPTSDVGTVILHWSSAVAM
FT                   VASLVTGLRISADALDAVVSRWISPVLPQGEVWTVHIFAGLLLFAVSVAYVVYMARSGL
FT                   ANRITLRKMRALQYAQTASLRWMGVNVLLHWLLFGLVTVLAATGILLYLGHGGWVVTVH
FT                   EAAAYGTLAYTLAHLVGHFGYGGWRQWLRIFRPAALVPSPAQRSRRPMLVAGLVTVPAV
FT                   AGAVALDLGSRGTLTVERVETPPVLDGVLDDAAWRAARPVRVRTQQGANLGGSGESTVE
FT                   IRAVQDGSRIHFAFRWQDPTRSLARLPMVKQADGWHVHGKGAGEADVVDFYEDKFAAIF
FT                   SHADGFGAAGVTHLGQKPLADKPSSLNRRGLHYTTDGSIVDMWQWKASRGGLLGHVDDQ
FT                   YMGPPREPTPDEAAQRARYQGGYWNDPGTTIYSYNFPFEGPGGYAGPVKPKRLPVDAAA
FT                   TMAALGRFDLANPDASYDEGSRWWLTEADSRPYSEEDDARIPVGTVIPGVLNIGRYEGD
FT                   RADLRGGARWKDGFWTLEVSRALRTGSRYDVDFVKGEPLYLWVAVFDHTQTRHTRHVRP
FT                   VRIDLR"
     atgaacgaga tggtgtcgaa ggatcggctc gcggctgtgc ggccgcaggc ggtcggcgct        60
     cgaccgaagg gcgatcgcct gccgacgagc gatgtcggca ccgtgatcct gcactggtcg       120
     agcgcggtcg ccatggtggc aagcctcgtg acgggcttac gcatctcggc cgatgcgctc       180
     gatgcggtgg tgtcgcgctg gatatcgccg gtgctgccgc agggcgaggt ctggaccgtt       240
     cacatctttg ccggtctgct gctcttcgcg gtgtcagtgg cctatgtcgt ctacatggcg       300
     cgcagcggcc tcgcgaaccg gatcacgctg cgcaagatgc gggcgctcca gtacgcccag       360
     accgcgtcgc tgcgctggat gggcgtcaac gtcctcctgc actggctgct gttcgggctc       420
     gtcaccgtgc tcgccgcgac cggcatcctg ctctatctcg gccatggcgg ctgggtcgtg       480
     acggtgcatg aggcggcggc ctacggcacc ctcgcctata cgctggccca cctcgtcggg       540
     catttcggct atggcggctg gcggcaatgg ctgcggatct tccggccggc cgcgctcgtg       600
     ccgagcccgg cccagcgcag ccgccggccg atgctggtgg cgggcctcgt cacggtcccg       660
     gcggtcgcgg gcgccgtcgc gctcgatctc ggcagccgcg gcacgctcac ggtggagcgg       720
     gtcgagacgc ccccggttct cgacggcgtg ctcgacgacg ccgcttggcg ggccgcccgc       780
     ccggtgcggg tgcggaccca gcagggtgcc aatctcggcg gcagcggcga atccaccgtc       840
     gagatccgcg ccgtgcagga cggcagccgg atccatttcg ccttccgctg gcaggatccg       900
     acccgctccc tcgcgcggct gccgatggtc aagcaggcgg atggctggca tgtccacggc       960
     aagggcgccg gcgaggccga cgtcgtcgac ttctacgagg acaagttcgc ggcgatcttc      1020
     tcgcatgcgg acggattcgg ggccgccggc gtcacccatc tcgggcagaa gcctctcgcc      1080
     gacaaaccct cctccctcaa ccggcgcggc ctgcactaca ccaccgacgg ctccatcgtg      1140
     gacatgtggc agtggaaggc ctcccgcggc ggccttctcg gccatgtgga cgaccagtat      1200
     atgggcccgc cccgcgagcc gacgccggac gaggcggccc agcgcgcccg ctaccagggc      1260
     ggctactgga atgatcccgg cacgacgatc tacagctaca atttcccgtt cgaggggccg      1320
     ggcggctatg cggggccggt gaagccgaag cggctgccgg tcgacgcggc ggccaccatg      1380
     gcggcgctcg gccggttcga cctcgccaac cccgacgcgt cctacgacga gggcagccgc      1440
     tggtggctca ccgaggcgga ttcccgtccc tacagcgagg aggacgatgc ccgcattccg      1500
     gtcggcacgg tgatacccgg cgtgctcaat atcggccgct acgagggcga ccgggcggat      1560
     ctgcgcggcg gcgcccgctg gaaggacggg ttctggactc tcgaagtgtc ccgcgccctg      1620
     aggaccggca gccgctacga cgtcgatttc gtgaagggcg aaccgctcta cctctgggtc      1680
     gcagtcttcg atcacaccca gacccgacac acgcggcatg tccgccccgt ccgcatcgac      1740
     ctgcgctga                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page