(data stored in ACNUC7421 zone)

EMBL: CP001349.PE130

CP001349.PE130       Location/Qualifiers
FT   CDS_pept        147609..148652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0136"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: met:M446_2675 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55182"
FT                   /db_xref="GOA:B8IUD7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD7"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACL55182.1"
FT                   /translation="MSSTCSLVINGKAIRAARGDTLVEAALAGKIVIPHDCGTGQCDTC
FT                   RVRIYAGEVDACGTRQGSTVLACQARVSGDAVIEFDAVPAVVKRKGTVTGLVALSPEIV
FT                   EVTVALGKGLGHRPGQYVACSFAGFPARDYSPTLRSDGSGELNELIFHIRRIPDGIVSS
FT                   ELGRRIRVGHEVRVRGPFGSAFHRLGSGRLVLIGAGTGWAPIWSIARAARFREPDREMV
FT                   VIAGARDPHNLHMGEALDWLSRSGVGQVVATASGGEPKPGQLAGRPTAHLPHLRESDVV
FT                   HVAGSPALVAAIRLLAASVNATCYADPFVASARKRSLRHKLFDLLFARRPSADPEVPVP
FT                   AAPRSAA"
     atgtcctcga cctgctcgct cgtcatcaac ggcaaggcca tccgggccgc gcggggggat        60
     accctcgtgg aggctgcact ggcgggcaag atcgtcatcc cgcacgattg cggcacgggc       120
     cagtgcgaca cctgccgggt gcgtatctat gcgggcgagg tggatgcgtg cggcacccgg       180
     caggggagca cggtgctcgc ctgccaggcc agggtctcgg gcgacgcggt gatcgagttc       240
     gacgcggtcc cggccgtggt gaagcgcaag ggcacggtca ccggtctcgt cgcgctctcg       300
     cccgagatcg tcgaggtgac ggtcgcgttg ggcaaggggc tcggccaccg tcccggacaa       360
     tacgtcgcct gcagcttcgc gggctttccg gcgcgggact acagcccgac cctgcgcagc       420
     gacggatcgg gcgagctgaa cgagctgatc ttccacatcc ggcgcatccc cgacgggatc       480
     gtctcgtccg agctcggccg gcgcatccgc gtcggccatg aggtgcgggt gcgcgggccc       540
     ttcggcagcg ccttccatcg gctcggatcg ggccgactcg tgctgatcgg cgcgggaacc       600
     ggctgggcgc cgatctggag catcgcccgc gccgcgcgct tccgcgagcc cgaccgcgag       660
     atggtggtca tcgcgggtgc ccgcgatccc cacaacctcc acatgggcga ggcgctcgac       720
     tggctgagcc gcagcggcgt cgggcaggtg gtcgccaccg cgagcggcgg cgagcccaag       780
     cccgggcagc tggcggggcg ccccacggcc catctcccgc acctgcgcga gagcgacgtg       840
     gtgcatgtcg ccggctcccc ggcgctcgtc gcggcaatcc gcctgctcgc ggcgagcgtg       900
     aacgccacct gctacgccga tcccttcgtg gcctccgcgc gcaagcgctc gctccgccac       960
     aagctgttcg atctgctctt cgcgcgccgt ccctccgccg atccggaggt tccggtcccg      1020
     gcggcacccc ggagcgcggc ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page