(data stored in ACNUC7421 zone)

EMBL: CP001349.PE132

CP001349.PE132       Location/Qualifiers
FT   CDS_pept        149158..149574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0138"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; protein of unknown function UPF0150; KEGG:
FT                   nha:Nham_0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55184"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD9"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ACL55184.1"
FT                   /translation="MARIVMLIHEEGGVYGASFPDFPGATTVAGDLDTLYTKAAEMLAF
FT                   HVEGMVEDGDEIPVPRTLQELREDPVFREDAEGAIIGLVEVELPGKAVRVNISIEESIL
FT                   RRIDRAAETAGETRSGFLVAAAKARLAQTSGVSR"
     atggcccgta tcgttatgct gattcacgag gaagggggcg tctacggcgc ctcctttcct        60
     gacttccccg gcgcgacgac cgtcgcggga gatctggaca cgctctacac caaggccgcc       120
     gagatgctgg ccttccacgt cgagggcatg gtcgaggacg gggacgagat cccggtcccg       180
     cgcaccctgc aggagctccg ggaggaccct gtcttccggg aagatgccga gggcgcaatc       240
     atcggcctcg tggaggtcga gctgcccggc aaggcggtgc gcgtgaacat ctccattgag       300
     gagagcatcc tacgccgcat cgaccgcgcc gccgagacgg cgggcgagac ccgctcgggc       360
     ttcctcgttg ccgccgcgaa ggcacgtctc gcgcagacca gcggcgtcag ccggtag          417
//

If you have problems or comments...

PBIL Back to PBIL home page