(data stored in ACNUC7421 zone)

EMBL: CP001349.PE133

CP001349.PE133       Location/Qualifiers
FT   CDS_pept        complement(149680..150477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55185"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE0"
FT                   /inference="similar to AA sequence:KEGG:M446_2676"
FT                   /protein_id="ACL55185.1"
FT                   /translation="MPSAPRLALALAACLFARPSLAAELAVVGTGDGIDLLRALGTSAH
FT                   EADASLEIAVPPSIGSDGGIAAVGSGKSPLARVARRLTEAETARGLVYTPIARLPSAIF
FT                   VHPSARVAGLTADQLLAIYAGRVTNWKEVGGADLRIRVVRREEADSTLRILRASMPGWA
FT                   DLVITERSKTAVSTQEAIETVRLVEGAIGFGPYSRTLEVGTRVLAIDGRLPTDPGYPSA
FT                   GELAFVHMNGQLPPAASRFVSFAQQAATAHEVIRSFGAVPIER"
     atgccgtccg ccccgcgcct cgccctggcc cttgcggcct gtctgttcgc acgcccaagc        60
     ctcgctgccg agctcgccgt cgtcgggacc ggggacggga tcgatctgct gcgggccctc       120
     gggaccagcg cgcacgaggc cgatgcgagc cttgagatcg ccgtgccgcc cagcatcggg       180
     tcggacgggg gaatcgcggc ggtcggctcg gggaagtcgc cgctcgcccg cgtggcgcgg       240
     cggctcaccg aggcggagac cgcccgcggt ctcgtctaca cgccgatcgc ccggcttccc       300
     tccgcgatct tcgtccaccc gagcgcgagg gtcgcggggc tgactgcgga ccagctcctg       360
     gccatctatg ccggccgggt gacgaactgg aaggaggtgg gcggcgccga cctgcgcatc       420
     cgcgtggtgc gccgggagga ggccgacagc acgctgcgga tcctgcgcgc cagcatgccg       480
     ggctgggccg atctcgtcat caccgaacgc tccaagaccg cggtctcgac ccaggaggcg       540
     atcgagacgg tgcgtctggt cgagggggcg atcggcttcg gcccctacag ccgcacgctc       600
     gaggtgggaa cccgggttct cgccatcgac gggcggctcc cgaccgatcc cggctatccg       660
     agcgcgggcg aactcgcctt cgtccacatg aacgggcagc tgccgcccgc cgcttcccgc       720
     ttcgtcagct tcgcgcaaca ggccgccacg gcgcacgagg tcatccgcag cttcggcgcg       780
     gtgccgatcg agcgctaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page