(data stored in ACNUC7421 zone)

EMBL: CP001349.PE134

CP001349.PE134       Location/Qualifiers
FT   CDS_pept        complement(150626..151825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0140"
FT                   /product="hydrolase, peptidase M42 family"
FT                   /note="TIGRFAM: hydrolase, peptidase M42 family; PFAM:
FT                   peptidase M20; peptidase M42 family protein; KEGG:
FT                   met:M446_2678 peptidase M42 family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55186"
FT                   /db_xref="GOA:B8IUE1"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017537"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE1"
FT                   /inference="protein motif:TFAM:TIGR03106"
FT                   /protein_id="ACL55186.1"
FT                   /translation="MNKPFAAASAAIASAPMRIDVDYMLDFLKRLIEIPSPTGYTDQAV
FT                   HFCGRELERLGVPFELTRRGAIRATLKGAGPGPARAMVSHLDTLGAMVKQLKDNGRLAL
FT                   VPIGTWSARFAEGARCTIFTDQGSYRGTILPLKASGHTFNEEVDTQPVDWTNVEMRVDA
FT                   FSYRVEDLRRLGFNVGDFVAVDPNPEFSPRGYLNSRHLDDKAGVAVMIAAMKAMADAGR
FT                   KPTVDTFMLFTIAEEIGVGASSVLHGDIAEMVTIDNGTVAPGQASRESGVTICMADSAG
FT                   PFDYHLTRRLIELCEANDIRYERDAFRYYRSDSASALEAGNDLRTALICFGVDSSHGYE
FT                   RTHVNALRSLAELSCLYLQSDVLFGRDVKPLGPLAGFPRQESESADPASEMVEDTILPG
FT                   "
     gtgaacaagc ccttcgcggc cgcgtccgcg gcgatcgcat ccgcgccgat gcggatcgac        60
     gtcgactaca tgctcgactt cctcaagcgc ctgatcgaga tcccgtcccc gacgggctac       120
     accgatcagg cggtgcattt ctgcgggcgc gagctggagc ggctcggcgt gcccttcgag       180
     ctgacgcggc gcggagccat ccgggcgacc ctcaagggcg ccgggccggg gccggcgcgg       240
     gccatggtct cgcacctcga cacgctcggg gcgatggtca agcagctcaa ggacaacggc       300
     cgtctcgcgc tcgtgccgat cgggacctgg tcggcccgct tcgcggaggg cgcccgctgc       360
     acgatcttca ccgatcaggg cagctaccgc ggcaccatcc tgccgctgaa ggcctccggc       420
     cataccttca acgaggaggt cgatacccag ccggtcgact ggaccaacgt ggagatgcgg       480
     gtcgacgcct tctcctatcg ggtggaggac ctgcgccggc tcggcttcaa cgtcggcgat       540
     ttcgtcgccg tggatccgaa tccggaattc tcgccgcgcg gctacctcaa ttcgcgccat       600
     ctcgacgaca aggcgggcgt cgccgtgatg atcgcggcca tgaaggccat ggcggatgcc       660
     ggccgcaagc cgacggtcga taccttcatg ctgttcacca tcgccgagga gatcggcgtc       720
     ggggcatcct ccgtgctgca tggggacatc gccgagatgg tgacgatcga caacggcacc       780
     gtggcgcccg gccaggcgag ccgcgaatcc ggcgtcacga tctgcatggc ggattcggcc       840
     ggcccgttcg actatcacct gacgcgccgg ctgatcgagc tctgcgaggc caacgacatc       900
     cgctacgagc gggacgcctt ccggtactac cgcagcgaca gtgcctcggc gctggaggcc       960
     ggcaacgatc tgcgcaccgc gctgatctgc ttcggcgtgg attcctcgca cggctacgag      1020
     cgcacgcatg tgaatgccct gcgctcgctc gcggagctct cctgcctgta cctgcagagc      1080
     gacgttctgt tcggccgcga cgtgaagcct ctcggaccgc tcgccggctt cccgcgccag      1140
     gagagcgaga gcgccgatcc ggcaagcgag atggtcgagg acacgatcct ccccggctga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page