(data stored in ACNUC7421 zone)

EMBL: CP001349.PE135

CP001349.PE135       Location/Qualifiers
FT   CDS_pept        complement(151828..153537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0141"
FT                   /product="GNAT-family acetyltransferase TIGR03103"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: GNAT-family acetyltransferase TIGR03103;
FT                   PFAM: phosphoribosylglycinamide synthetase; GCN5-related
FT                   N-acetyltransferase; RimK domain protein ATP-grasp; KEGG:
FT                   met:M446_2679 GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55187"
FT                   /db_xref="GOA:B8IUE2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017534"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE2"
FT                   /inference="protein motif:TFAM:TIGR03103"
FT                   /protein_id="ACL55187.1"
FT                   /translation="MANPIPMPSSAEQSAPAAANVAVECGWGRLIFGQTFRDPADLVDL
FT                   LLQEQPGRRDVAFYVAEPHVVLALAPTELFLDPSHAYRLDLRGFDAAAGAPQGFRVRPV
FT                   TGSADIAEINRICRARHMVQIDPAFAWPPREDGVLTYLVAEDSQTGAILGAATGIDHVA
FT                   AFGDSENASSLWSLAVDPQTPHPGVGEGLVRALAGHFRARGREVMDLSVMHDNAQAIAL
FT                   YEKLGFVRLPVFTIKTKNSFNEKLYIGPSPDGALNPYAQIITNEARRRGITVEVVDEPT
FT                   SLFRLSHGGRSFVCRESLSSATSAAAMTICDDKALTRRLLAGAGLRVPDQGVATDEAAA
FT                   RAFLKKHGAVVVKPARGEQGRGIAVNLTTPEEVSAAVAEAKRVCDTVLLEEFVEGEDLR
FT                   VIVIDFKVVAAAIRRPAQVVGTGRHSVRELIERQSRRRAAATGGESRIPLDDETRRCVE
FT                   RAGHSLDDVPAAGATLLVRRTANLHTGGTIHDVTDAIHPELVAASVKAARVIDIPVVGL
FT                   DLMVPDIRGPEHWFIEANERPGLANHEPQPTAERFVDMLFPQTIAAARVRRH"
     atggcgaatc ccatcccgat gccgtcctct gccgaacaat ccgcccccgc ggcggccaac        60
     gtcgccgtcg agtgcggctg gggacggctg atcttcggcc agaccttccg cgatccggcg       120
     gacctcgtcg accttctgct ccaggagcag ccgggccggc gcgacgtggc cttctacgtc       180
     gccgagccgc atgtggtgct ggcgctcgcc ccgaccgagc tgttcctcga cccgtcgcac       240
     gcctaccggc tcgacctgcg cggcttcgac gcggcggccg gagcgccgca gggattccgc       300
     gtgcggccgg tgacgggatc ggccgacatc gcggagatca accgcatctg ccgcgcccgc       360
     cacatggtgc agatcgaccc ggccttcgcg tggccgcccc gggaggacgg ggtcctgacc       420
     tacctcgtcg cggaggattc ccagaccggc gcgatcctcg gcgcggcaac gggcatcgac       480
     cacgtggcgg ccttcggcga ttccgagaac gcctcctcgc tctggtccct cgcggtcgat       540
     ccgcagacgc cgcatccggg cgtcggcgag gggctggtgc gggcgctcgc cgggcatttt       600
     cgggcgcgcg ggcgcgaggt catggacctg tcggtcatgc acgacaacgc gcaggcgatc       660
     gctctctacg agaagctcgg cttcgtccgg ctgccggtct tcaccatcaa gaccaagaat       720
     tccttcaacg agaagctcta tatcgggccc tcgccggatg gggccctgaa cccctacgcc       780
     cagatcatca ccaacgaggc gcgccggcgt gggatcaccg tcgaggtggt ggacgagccg       840
     acctcgctgt tccgcctctc ccatggcggg cgcagcttcg tctgccgcga gagcctttcc       900
     tcggcgacct cggccgccgc gatgacgatc tgcgacgaca aggccctgac ccggcgcctt       960
     ctcgccggag cgggcctgcg cgtgcccgac cagggcgtcg ccaccgacga ggcggcggcc      1020
     cgcgccttcc tcaagaaaca cggcgccgtg gtggtgaaac cggcccgcgg cgagcagggc      1080
     cgcggcatcg ccgtgaatct caccacgccc gaggaggtga gcgcggcggt ggcggaggcg      1140
     aagcgcgtct gcgacacggt cctgctcgag gaattcgtgg agggcgagga cctgcgcgtc      1200
     atcgtcatcg acttcaaggt ggtggcggcg gcgatccgcc ggcccgcgca ggtggtcggc      1260
     accgggcggc acagcgtgcg cgagctgatc gagcggcaga gccggcggcg ggccgccgcg      1320
     acgggcggcg agtcgcggat cccgctcgac gacgagacca ggcgctgcgt cgagcgggcc      1380
     ggtcacagcc tcgacgacgt gccggcggcc ggcgccacgc tcctggtgcg gcgcaccgcc      1440
     aatctccata ccggcggcac catccacgac gtcaccgacg cgattcaccc ggagctcgtg      1500
     gcggcctccg tcaaggccgc acgggtgatc gacattccgg tggtcgggct cgacctgatg      1560
     gtcccggaca tccgcgggcc cgaacactgg ttcatcgagg ccaacgagcg gcccgggctc      1620
     gccaaccacg agccccagcc gacggccgag cgcttcgtcg acatgctgtt tccccagacg      1680
     atcgccgccg cgcgggtccg gaggcattga                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page