(data stored in ACNUC7421 zone)

EMBL: CP001349.PE136

CP001349.PE136       Location/Qualifiers
FT   CDS_pept        complement(153541..155313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0142"
FT                   /product="asparagine synthase family amidotransferase"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); asparagine synthase family
FT                   amidotransferase; PFAM: glutamine amidotransferase
FT                   class-II; asparagine synthase; KEGG: met:M446_2680
FT                   asparagine synthase amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55188"
FT                   /db_xref="GOA:B8IUE3"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017535"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE3"
FT                   /inference="protein motif:TFAM:TIGR03104"
FT                   /protein_id="ACL55188.1"
FT                   /translation="MCGICGEIRLDGAPPDAAAVAAMAVPLRARGPDAGGSFAQGGIAF
FT                   GHRRLSILDLSPASQQPMVDPGLGLAIVFNGCIYNFRSLREELRAKGYAFFSEGDTEVI
FT                   LKAYHAWGPRCVERFYGMFAFVLWERDSGRVVIARDRLGIKPLYYAESGSRLRFASSLP
FT                   ALLAAGDLDRSIDPAALHHYMSFHAVVPAPLTILKGVRKVPPATIITIEPDGRRRQETY
FT                   WEAVVTERPDDRHMTESDWCEAVLATLRKAVERRLVSDVPVGVLLSGGLDSSIVVALLA
FT                   EAGQRGLKTFSIGFESVGGEAGDEFTYSDIIAERFATDHHRIRIDSARALPALHGAVAA
FT                   MSEPMVSHDAVGFYLLSEEVSKHVKVVQSGQGADEIFGGYHWYPPMMQSTDAVADYARV
FT                   FFDRDHAEMREALSPSLVDGDVSRAFVEAHFARAGAPRPIDKALRIDTEIMLVDDPVKR
FT                   VDNMTMAWGLEARVPFLDHDLVELAGRVPADLKIRDGGKFILKQAGRRVVPSEVIDRPK
FT                   GYFPVPALKYLRGPFLDLVRDVLNEPVARERGLFNRAYVDRLLAEPEAHMTPLRGSKLW
FT                   QVALLEFWLQTHAI"
     atgtgcggaa tctgcggcga aatccggctg gacggcgccc cgccggacgc ggcggcggtg        60
     gcggcgatgg ccgtgccgct ccgggcgcgg ggccccgatg ccggcggcag ctttgcgcag       120
     ggcggcatcg ccttcgggca ccggcgcctc agcatcctcg acctcagccc ggcctcgcag       180
     cagccgatgg tcgatccggg gctcggcctc gccatcgtct tcaatggctg catctacaat       240
     ttccgcagcc tgcgcgagga gttgcgcgcg aaaggatacg cgttcttctc ggagggcgac       300
     acggaggtga tcctcaaggc ctatcacgcc tgggggccgc gctgcgtcga gcgcttctac       360
     ggcatgttcg ccttcgtgct gtgggagcgc gacagcggac gcgtcgtcat cgcgcgcgac       420
     cggctcggga tcaagcctct ctactatgcg gaatcgggct ctcgcctgcg cttcgcgtcg       480
     agcctgccgg cgcttctcgc cgccggcgac ctcgaccgct cgatcgatcc cgcggcgctc       540
     caccactaca tgagcttcca tgcggtggtg cctgcgcccc tcaccatcct gaagggcgtg       600
     cgcaaggtgc cgccggcgac gatcatcacg atcgagccgg acggacggcg ccggcaggag       660
     acctactggg aggccgtcgt gactgagcgg ccggacgacc gccacatgac ggaaagcgat       720
     tggtgcgagg cggtcctcgc caccctgcgc aaggcggtgg agcgccggct cgtctccgac       780
     gtgccggtcg gcgtgctgct ctcgggcggc ctcgacagct cgatcgtggt ggcgctgctg       840
     gcggaggccg ggcagcgggg cctcaagacc ttctcgatcg gcttcgagag cgtcggcggc       900
     gaggcgggcg acgagttcac ctattccgac atcatcgccg agcgcttcgc caccgaccac       960
     caccgcatcc gcatcgactc ggcgcgcgcc ctgccggcgc tgcacggggc cgtcgcggcc      1020
     atgtccgagc cgatggtcag ccacgatgcg gtcggcttct atctcctctc cgaggaggtc      1080
     tcgaagcacg tcaaggtcgt gcagagcggg cagggggccg acgagatttt tggcggctat      1140
     cactggtatc cgccgatgat gcaatcgacc gacgcggtgg cggattacgc gcgcgtcttc      1200
     ttcgaccgcg accacgccga gatgcgggag gcgctgtcgc cgagcctggt cgacggcgat      1260
     gtcagccgcg ccttcgtgga ggcgcatttc gcacgggccg gcgcgccgcg gccgatcgac      1320
     aaggcgctgc gcatcgacac cgagatcatg ctggtggacg accccgtgaa gcgggtcgac      1380
     aacatgacca tggcctgggg gctcgaagcc cgcgtgccct tcctcgacca cgatctcgtc      1440
     gaactcgcag ggagggtgcc cgccgatctc aagatccggg acgggggcaa gttcatcctc      1500
     aagcaggcgg gccgccgggt cgtgccctcg gaggtgatcg accgcccgaa gggctacttc      1560
     ccggtgccgg cgctcaagta tctgcgcggg cccttcctcg atctcgtgcg cgacgtcctg      1620
     aacgagccgg tcgcccgcga gcgcggcctg ttcaaccggg cctatgtcga ccggctgctg      1680
     gccgagcccg aggcccacat gaccccgctg cgcggctcca agctctggca ggtcgcgctg      1740
     ctcgaattct ggctccagac ccacgcgatc tga                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page