(data stored in ACNUC7421 zone)

EMBL: CP001349.PE137

CP001349.PE137       Location/Qualifiers
FT   CDS_pept        155543..155935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0143"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_2682 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55189"
FT                   /db_xref="GOA:B8IUE4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55189.1"
FT                   /translation="MGGGRVENVLVVEDEVLLLDLVTAELEDAGLTVLQADNANAALGM
FT                   LATDTPVDLLFTDIRLPGPMDGWTLAEAALKLRPGLKVIYATGFAGDAPRLAPGSLFFT
FT                   KPYRPSAVIAAIAAFGTAEPPSPAVP"
     atgggcggcg gacgggtgga gaacgtgctg gtcgtcgagg acgaagtgct tctcctcgat        60
     ctcgtgacgg cggaactgga agatgccggg ctcaccgtcc tccaggccga caacgccaat       120
     gccgcgctcg ggatgctggc caccgatact cccgtcgatc tcctgttcac ggatatccgc       180
     cttcccggcc cgatggacgg ctggaccctc gccgaggccg ccctgaagct gcggcccggc       240
     ctgaaggtga tctatgcgac gggcttcgcc ggcgacgccc cgcggctggc accgggcagc       300
     ctcttcttca ccaagcccta ccgcccctcc gcggtcatcg cggcgatcgc ggcattcggg       360
     acggctgagc cgccgagtcc cgcagtcccc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page