(data stored in ACNUC7421 zone)

EMBL: CP001349.PE138

CP001349.PE138       Location/Qualifiers
FT   CDS_pept        156242..159271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0144"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: met:M446_2683 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; Hpt domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55190"
FT                   /db_xref="GOA:B8IUE5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACL55190.1"
FT                   /translation="MARAGMKASTETPLDRIDRLRPSTRTPGTRRSACATLLIGVSGLT
FT                   GWAGAAVAGESSALPAGWFGPALGIGLAAAVAAAAAAGAAAAAAIVLWRGRAQRASGAG
FT                   ARVGTGPPAAAAAASGPESRVDAARTAALLGKTLDCMDQGVILVGPDRTVQVANRRARE
FT                   WLGLSEAFIASRPSYREVRALARRSPHWGSLVADTPLQLSEDDPAATHTVAERRNAEGT
FT                   VLEIRTVRTEDGGLIQTLTDITERRSAEDRYRLLAENATDLISLQSIRGGTKTYVSPSA
FT                   RAVVGWEPEEFAQLTLAQQLHPDDLARVKREAASLTPDAPRRTSEYRLRHKSGHYVWVE
FT                   STLLLTKPGTPDEALIIASRDVTARRAADDALRESEARHRLLAERTGDVIARADLDGTL
FT                   RYLSPSVEPVTGYAADALLGRSAMAHVHPQDRRTVLHRYAALVAAGPGARAKFEYRVRH
FT                   RHGHDVWLEVNPTVLYDEATGVPLGFVDVARDVTARKAVDAELAAAREQAEAARVHAEL
FT                   ASQAKTDFLASMSHEIRTPLSSVIGYTELLLDDPDLTEGQRLQASRIRSAGSALLTVVD
FT                   DILDFSKIEAGQVDLDLMPFALHGLIENAVAIVRQLAERKGLEIRVDIDPALPQTLVGD
FT                   QNRLRQILLNFLNNALKFTRRGRVVLAVATAGSTDRGWPIRVSVTDTGIGIAPEQQARL
FT                   FKRFTQVDGSIRREFGGTGLGLAISKKLIELMGGAIGVVSAPGEGSTFWFEVVLPEASA
FT                   APAPAEAPLARPVRPARILLVEDLIVNQDLARAVLERAGHMVDVANDGLEAIAAVQAKD
FT                   YDLVLMDVQMPGMDGVTATRHIRALPQRVSLIPIIAMTANVLPAQVSEFRAAGMNDHLG
FT                   KPFRRDELQAVIDRWIGEGTVAPHPGAGAAAAVDRRVYDDVVDLLGPDRLAHFLDELAR
FT                   EIRDRLSDARLAADDPQRLARDAHSLVASAGTLGFSELSGLCKQLEEACQSGASGDLLA
FT                   AVRASRDRALDEIERLHTVA"
     atggcgcgcg ccgggatgaa ggcgtcgacc gagactcccc tcgatcggat cgaccggttg        60
     cgcccatcga cccggacgcc cggcacgcgg cgcagcgcgt gcgcgaccct tctgatcggc       120
     gtgagcgggc tcacgggctg ggctggtgcg gcagtggccg gcgagtcatc cgcgctgccg       180
     gcgggctggt tcgggccggc cctggggatc ggcctcgcgg ccgccgtggc ggccgctgcc       240
     gcggcgggtg ctgccgcggc cgccgcgatc gtcctttggc gcggccgcgc gcagcgggcc       300
     tcgggggccg gtgcgcgggt cggcacgggg ccaccggccg cggcggcagc ggcctccgga       360
     ccggaaagcc gcgtcgatgc cgcccgcacc gccgccctcc tcggcaagac cctcgactgc       420
     atggatcagg gcgtgatcct cgtgggcccg gaccgcaccg tgcaggtcgc caaccggcgc       480
     gcgcgcgagt ggctcggcct gtccgaagcc ttcatcgcca gccggccgag ctaccgcgag       540
     gtccgggcac tggcccggcg cagcccgcac tggggatcgc tcgtcgcgga tacgcccctg       600
     cagctctcgg aggacgatcc ggccgcgacg catacggtcg ccgagcggcg caatgccgag       660
     ggcaccgtgc tggagatccg cacggtccgc accgaggatg gcggcctgat ccagacgctg       720
     accgacatca ccgagcggcg cagtgcggag gaccgctatc gcctcctggc cgagaacgcc       780
     acggacctga tctccctgca gtcgatccgg ggcggcacga agacctacgt ctcgccctct       840
     gcgcgcgccg tcgtcggctg ggagcccgag gagttcgcgc agctcacgct cgcgcagcag       900
     ctccatcccg acgacctcgc gcgcgtgaag cgcgaggccg ccagcctcac cccggatgcg       960
     ccgcggcgga cgagcgagta ccgcttgcgg cacaagtccg gccactacgt ctgggtcgag      1020
     tcgacgctcc tcctcaccaa gcccggcacg ccggacgagg ccctgatcat cgcctcgcgc      1080
     gacgtcacgg cccggcgggc cgccgacgac gcgctgcgcg agagcgaggc gcgccaccgc      1140
     ctcctggcgg agcggacggg cgacgtcatc gcccgcgccg acctcgacgg cacgctgcgc      1200
     tacctgtcgc cgtccgtgga gccggtgacg ggctacgcgg ccgacgcgct gctcggccgc      1260
     tccgccatgg cccacgtgca cccgcaggat cgccggaccg tgctccaccg ctacgccgcc      1320
     ctcgtcgccg cagggccggg ggcgcgcgcg aagttcgagt accgggtgcg tcaccggcac      1380
     ggccacgacg tctggctcga ggtgaacccg acggtgctct acgacgaggc caccggcgtc      1440
     cctctcggat tcgtcgacgt cgcccgcgac gtcaccgccc gcaaagccgt tgacgcggaa      1500
     ctcgccgccg cccgcgagca ggccgaggcc gcgcgcgtcc atgcggagct cgcgagccag      1560
     gcgaagaccg acttcctggc ctcgatgagc cacgagatcc gcacgccgct gagcagcgtg      1620
     atcggctaca cggagctgct cctcgacgat ccggatctga ccgagggcca gcgcctgcag      1680
     gcttcccgga tccgctcggc cggctcggcc ctgctgacgg tggtggacga catcctcgat      1740
     ttctcgaaga tcgaggccgg tcaggtcgat ctcgacctga tgcccttcgc gcttcatggc      1800
     ctgatcgaga atgcggtcgc catcgtgcgc cagctcgcgg agcgcaaggg gctggagatc      1860
     cgggtcgaca tcgatccggc cctgccccag accctggtcg gcgaccagaa ccgcctgcgg      1920
     cagatcctgc tcaacttcct caacaacgcc ctcaagttca cgcggcgcgg ccgggtcgtg      1980
     ctcgcggtcg cgacggcggg cagcaccgat cgcggctggc cgatccgggt ctcggtcacg      2040
     gatacgggca tcggcatcgc acccgagcag caggcccggc tgttcaagcg gttcactcag      2100
     gtggacgggt cgatccggcg cgaattcggc ggcaccgggc tcggcctcgc catctccaag      2160
     aagctcatcg agctcatggg cggggcgatc ggcgtggtga gcgcccccgg cgagggatcg      2220
     accttctggt tcgaggtggt gctgcccgag gcgagcgccg cgcccgcccc ggccgaggcg      2280
     ccgctggccc gcccggtgcg gccggcgcgg atcctcctgg tcgaggacct gatcgtcaat      2340
     caggaccttg cccgcgcggt tctggagcgg gccggccaca tggtcgatgt cgccaatgac      2400
     ggcctggagg cgatcgcggc cgtgcaggcc aaggactacg acctcgtgct gatggacgta      2460
     cagatgcccg gcatggacgg ggtgacggcc acgcggcata tccgggcgct tccccagcgg      2520
     gtctcgctca tcccgatcat cgccatgacg gcgaatgtcc tgccggcgca ggtcagcgag      2580
     ttccgtgcgg ccggcatgaa cgatcacctg ggcaagccgt tccggcgcga cgagctgcag      2640
     gcggtgatcg accgctggat cggcgaggga accgtggctc cgcaccctgg cgccggggct      2700
     gcggcggcgg tggaccgccg cgtctacgac gacgtcgtgg acctgctcgg cccggaccgc      2760
     ctcgcccatt tcctcgacga gctcgcccgc gagatccgcg accgcctgag cgatgcccgg      2820
     ctcgccgcgg acgatccgca gcgcctcgcc cgcgacgccc acagcctcgt ggcctcggcg      2880
     ggcacgctcg gcttctcgga actgtccggg ctgtgcaagc agctggagga ggcctgccag      2940
     tccggcgcct ccggggacct gctggcggcg gtccgcgcca gccgcgaccg ggcgctcgac      3000
     gagatcgagc ggttgcacac ggtggcctaa                                       3030
//

If you have problems or comments...

PBIL Back to PBIL home page