(data stored in ACNUC7421 zone)

EMBL: CP001349.PE139

CP001349.PE139       Location/Qualifiers
FT   CDS_pept        complement(159593..160138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0145"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   met:M446_4615 CoA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55191"
FT                   /db_xref="GOA:B8IUE6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE6"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ACL55191.1"
FT                   /translation="MPDVSNAARHDDYDTEHLRGLLRSVRSIALVGASANPARPSWIVT
FT                   KYLLERGYDVIPVNPGLAGQELLGRRVVGRLSELGRPVDMVEIFRNSEAAGPLVDEALA
FT                   LDPLPKVIWMQLGVRNDAAAAKAEARGITVVMNRCPKIEYGRLSGEIGWTGVNSRILSA
FT                   KRPKLAARGFQKLTIEKR"
     atgcccgacg tctccaatgc cgcccgtcac gatgactacg acaccgagca cctgcggggc        60
     cttctgcggt cggtgcgctc catcgcgctg gtgggggctt cggcgaaccc ggcccggccg       120
     agctggatcg tcaccaagta cctgctggag cgcggctacg acgtgatccc ggtcaatccg       180
     ggcctcgccg gccaggagct gctcgggcgt cgcgtggtcg ggcgcctgtc ggagctcggc       240
     cgcccggtcg acatggtcga gatcttccgc aattcggagg cggccggtcc cctcgtcgac       300
     gaggcgctgg cgctcgatcc gctgcctaag gtgatctgga tgcagctcgg ggtgcgcaac       360
     gacgcggcgg cggcgaaggc ggaggcccgt ggcatcaccg tcgtgatgaa ccgctgcccg       420
     aagatcgagt acggacgtct ctcgggcgag atcggctgga ccggcgtgaa ctcccggatc       480
     ctgagcgcca agcggccgaa gctcgccgcc aggggctttc agaagctcac catcgagaag       540
     cgctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page