(data stored in ACNUC7421 zone)

EMBL: CP001349.PE14

CP001349.PE14        Location/Qualifiers
FT   CDS_pept        complement(15663..16535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55066"
FT                   /db_xref="GOA:B8IT04"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT04"
FT                   /inference="similar to AA sequence:KEGG:M446_0010"
FT                   /protein_id="ACL55066.1"
FT                   /translation="MSDGKDQAGASAPGTSAASAEASLKDAVTSARAALPKAEAFRKVP
FT                   AFRLKLRPPIAAALLGGLCLGSFGGGAAVALLTKGARAERPAIGQAEWKKLATRLDAQA
FT                   AESARLATDIKLLKDRTAEAHDAAEKARAESGTRFGQLAERLDRLNKVGGETATKLAGL
FT                   SEKLDHFDREQSARVTALGEKVERQRSAAPAAPAPAAPAAKVAAAEPALTGSLPDKPAA
FT                   KPAPTLVDGWTLRDVYDGVAMIENRNRRLVEVGPGDTVPGIGRVEAIERRGKTWVVVTN
FT                   RGLITSQLW"
     atgagcgacg gcaaggatca ggccggggcg tcggcgcccg gcacgtcggc agcctccgcg        60
     gaggcgagcc tcaaggatgc ggtgacgagc gccagggctg cgctcccgaa ggccgaagcc       120
     ttccgcaagg ttccggcctt ccgcctgaag ctgcgcccgc cgatcgcggc ggcgctgctc       180
     ggcggcctct gcctcggctc cttcggaggc ggcgccgcgg tcgcgctcct caccaagggt       240
     gcccgagcgg agcggccggc gatcggacag gccgagtgga agaagctcgc gacgcgcctc       300
     gacgcgcagg ccgccgagtc cgctcgcctc gccaccgaca tcaagctcct caaggaccgc       360
     accgccgagg cgcatgatgc ggccgagaag gcgcgggccg agagcggcac gcgcttcggc       420
     cagctcgccg agcgcctcga ccggctgaac aaggtcggcg gcgaaacggc gacgaagctc       480
     gccggtctct ccgagaagct cgaccatttc gaccgcgagc aatccgcccg cgtgacggcg       540
     ctcggcgaga aggtcgagcg gcagcggagc gcggccccgg ccgctcctgc gcccgcggcg       600
     cccgccgcga aggttgccgc ggccgagccc gcgctgaccg gcagcctgcc cgacaagccg       660
     gccgcgaagc ctgcgcccac cctggtggac ggctggacgc tgcgcgacgt ctatgacggc       720
     gtggcgatga tcgagaaccg caaccggcgc ctcgtcgagg tggggccggg cgacaccgtc       780
     cccggcatcg gccgcgtcga ggcgatcgag cgccggggca agacctgggt cgtcgtgacg       840
     aaccggggcc tgatcacatc gcagctgtgg tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page