(data stored in ACNUC7421 zone)

EMBL: CP001349.PE140

CP001349.PE140       Location/Qualifiers
FT   CDS_pept        complement(160252..161034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0146"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   met:M446_4614 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55192"
FT                   /db_xref="GOA:B8IUE7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE7"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACL55192.1"
FT                   /translation="MDETAPLLTRRDHDSIATLTLNRPRARNALSAALLTVLREEFARL
FT                   AEDTTIRVVVLAAEGPAFCAGHDLKEMTSYRTEPDRGAARFAALFDLCSQVMMAIPALP
FT                   QPVIAAVEGVATAAGCQLVASCDLAVAGEEARFATPGVQIGLFCSTPMVALSRNLSRKA
FT                   AMAMLLTAEMVEAAEAKDLGLVNRVVPAGTALAEAQALAAGIAARSSYTVRVGKRAFYE
FT                   QVEMPLAEAYAHAGRVMTENMLARAAEEGIAAFLNRKG"
     atggacgaga ccgcccccct gctcacccgc cgcgaccatg acagcatcgc gaccctgacc        60
     ctgaaccgcc cgcgggcacg caacgccctg tcggcggcgt tgctgacggt tttgcgcgag       120
     gaattcgccc gcctcgccga ggacacgacg atccgggtgg tggtgctcgc cgccgagggg       180
     ccggccttct gtgcgggcca cgacctcaag gagatgacgt cctaccggac cgagccggac       240
     cgcggggcgg cgcgctttgc cgccctattc gacctctgct cgcaggtgat gatggcgatc       300
     ccggccctgc cgcagccggt gatcgcggcg gtggagggcg tggcgacggc ggccggctgc       360
     cagctcgtgg cgagctgcga cctcgcggtg gccggcgagg aggcccggtt cgcgacgccg       420
     ggggtgcaga tcgggctgtt ctgctcgacg ccgatggtgg cgctctcgcg caacctgtcg       480
     cgcaaggccg cgatggcgat gctgctcacc gccgagatgg tggaggcggc ggaggcgaag       540
     gatctcggcc tcgtcaaccg ggtggtccct gccggcacgg ccctcgcgga ggcgcaggcg       600
     ctcgccgccg ggatcgcggc ccgcagttcc tacacggtgc gggtcggcaa gcgcgccttc       660
     tacgagcagg tcgagatgcc gctcgccgaa gcctatgccc atgcgggccg ggtcatgacc       720
     gagaacatgc tggcgcgcgc ggcggaggag gggatcgccg ccttcctgaa ccggaagggg       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page