(data stored in ACNUC7421 zone)

EMBL: CP001349.PE141

CP001349.PE141       Location/Qualifiers
FT   CDS_pept        161145..161582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0147"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   met:M446_4613 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55193"
FT                   /db_xref="GOA:B8IUE8"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE8"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACL55193.1"
FT                   /translation="MPTDSLMSREAVIAFLDEVFPQIHHGGPGPVIEAVGPLSATLRLP
FT                   YHKRHLRPGGTISGPAMMALADLALYAAILANIGPVALAVTTNLSFNFMRKPAPRDLIG
FT                   EARLMKLGRQLAVGEVLIRSEGETALVCHATGTYAIPPRKS"
     atgccgacag acagcctgat gagccgcgag gcggtgatcg ccttcctcga cgaggtcttc        60
     ccgcagatcc accatggcgg cccgggtccg gtcatcgagg cggtggggcc gctctcggct       120
     accttgcgcc tgccctatca taagcggcat ctgcggccgg gcggcacgat ctcgggcccc       180
     gccatgatgg cgctcgccga cctcgcgctc tatgcggcga tcctcgcgaa tatcggcccg       240
     gtggcgctcg cggtgaccac caatctctcg ttcaacttca tgcgcaagcc ggccccccgc       300
     gacctgatcg gcgaggcgcg gctgatgaag ctcggccggc agctcgcggt cggcgaggtg       360
     ctgatccgca gcgagggaga gaccgctctc gtctgccacg ccaccggcac ctacgcgatc       420
     ccgccgcgca aaagttag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page