(data stored in ACNUC7421 zone)

EMBL: CP001349.PE142

CP001349.PE142       Location/Qualifiers
FT   CDS_pept        161760..162221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0148"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: ribosomal protein L13; KEGG: met:M446_4612
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55194"
FT                   /db_xref="GOA:B8IUE9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUE9"
FT                   /inference="protein motif:PFAM:PF00572"
FT                   /protein_id="ACL55194.1"
FT                   /translation="MKTFSLKPADVEKKWVIIDAEGLVVGRLASIVAMRLRGKHKPQYT
FT                   PHVDCGDNVIVINADKVKFTGRKYDQKVYYHHTGYPGGIKERSAKFILEGRFPERVVEK
FT                   AVERMLPRGPLFRKILGNLRVYKGSEHPHAAQQPETLDVAALNRKNVSA"
     atgaagacct tttcgctgaa gcccgccgac gtcgagaaga agtgggtgat catcgacgct        60
     gagggcctcg tggtgggccg tctcgcgtcg atcgtcgcga tgcgtctgcg gggcaagcac       120
     aagcctcagt atacgcccca cgtcgattgc ggcgacaacg tcatcgtgat caatgcggac       180
     aaggtgaagt tcaccggccg caaatacgat cagaaggtgt actaccacca caccggctat       240
     ccgggcggca tcaaggagcg ctcggcgaag ttcatcctcg aaggccggtt cccggagcgc       300
     gtggtcgaga aggcggtgga gcgcatgctg ccgcgcgggc cgctgttccg gaagatcctc       360
     ggcaatctgc gggtctacaa gggctcggag cacccccacg ccgcccagca gccggagacg       420
     ctcgacgtcg ccgctctcaa ccgcaagaac gtgagcgcgt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page