(data stored in ACNUC7421 zone)

EMBL: CP001349.PE143

CP001349.PE143       Location/Qualifiers
FT   CDS_pept        162223..162711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0149"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: met:M446_4611
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55195"
FT                   /db_xref="GOA:B8IUF0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUF0"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACL55195.1"
FT                   /translation="MATLQSLADLGQANKAALATADTEAPVHVQKLDAQGRAYATGKRK
FT                   DAVARVWIKPGAGTITVNDRPVDTYFARPVLRMILQQPLHVANRVDQYDIVVTVTGGGL
FT                   SGQAGAVRHGLARALTYYEPELRSPLKREGFLTRDPRVVERKKYGRKKARRSFQFSKR"
     atggcgaccc ttcagtccct cgccgatctc ggccaggcca acaaggcggc tctcgccacg        60
     gccgacaccg aggccccggt ccacgtccag aagctggacg cgcagggccg tgcctatgcc       120
     accggcaagc gcaaggacgc ggtcgcccgt gtctggatca agcccggcgc cggcaccatc       180
     acggtcaacg accgcccggt ggacacctac ttcgcccgtc cggtgctgcg gatgatcctg       240
     cagcagccgc tccacgtcgc gaaccgcgtc gaccagtacg acatcgtcgt gacggtgacg       300
     ggcggcggcc tctcgggcca ggccggcgcg gtgcgccacg gcctcgccag ggcgctgacc       360
     tactacgagc cggagctgcg ctcgcccctg aagcgcgagg gcttcctcac ccgcgacccg       420
     cgcgtcgtgg agcgcaagaa gtacggccgc aagaaggccc gtcgcagctt ccagttctcg       480
     aagcgctga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page