(data stored in ACNUC7421 zone)

EMBL: CP001349.PE144

CP001349.PE144       Location/Qualifiers
FT   CDS_pept        162897..163703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0150"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   met:M446_4609 peptidase S1 and S6 chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55196"
FT                   /db_xref="GOA:B8IUF1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF1"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACL55196.1"
FT                   /translation="MGRMTCIVAAAARRLAVARSLLIAGGLAASLPAQAIEGGVPASAR
FT                   DALARATVALGTLNQSGDNIQITRCSGVLIRRDLVLTAAHCVGESPLGAVVVFYRGSKP
FT                   VGPAYRAAAVSRFAVARDGAEAGDLGINLTALSLDIAVLRLAAPVRDRAPLPVGRAVRR
FT                   LPGHLLIAGVGLSGGAPGTLKTARLTPLAVTESGLTFARAEGALVCLGDSGGPVVTGGG
FT                   GGVRLWGVASAVITSTPPCGSLVVIAPAGRRLSAERGPVRAALLRR"
     atgggacgca tgacgtgcat cgtcgccgca gcggcgcgcc gcctcgctgt ggcccggtcg        60
     ctcctgatcg cgggcggtct cgccgcgagc ctgcccgcgc aggccattga aggcggtgtg       120
     cccgcgagcg cgcgggacgc gctcgcccgt gcgacggtgg cgctcggcac gctcaaccag       180
     tccggggaca acatccagat cacacgctgc tcgggcgtgc tgatcaggcg ggatctcgtc       240
     ctgacggccg cccattgcgt cggagagagc ccgctcggcg cggtcgtggt gttctatcgc       300
     gggagcaagc cggtcggccc ggcctatcgg gccgccgcgg tctcgcgctt cgcggtcgcc       360
     cgcgacgggg cggaggcggg cgacctcggc atcaacctca cggccctgtc cctcgacatc       420
     gccgtgctgc ggctcgccgc cccggtgcgc gaccgggccc cgttgcccgt gggccgcgcc       480
     gttcgccgct tgcccggcca tctgctgatc gccggcgtcg gcctgtcggg cggcgcgccc       540
     ggtacgctca agaccgcgcg cctgacgccg ctcgccgtca cagagagcgg cctcaccttc       600
     gcgcgggcgg agggcgccct cgtctgcctc ggcgattccg gcggcccggt cgtcaccggc       660
     ggcggtggcg gcgtgcggct ctggggcgtg gcgagcgccg tcatcacctc gacgccgccc       720
     tgcggcagcc tcgtggtgat cgccccggcg ggccggcgcc tcagcgcgga acggggtccg       780
     gtccgcgcgg cgcttctgcg gcgctaa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page