(data stored in ACNUC7421 zone)

EMBL: CP001349.PE145

CP001349.PE145       Location/Qualifiers
FT   CDS_pept        complement(163794..164342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0151"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: met:M446_4608 YbaK/prolyl-tRNA synthetase associated
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55197"
FT                   /db_xref="GOA:B8IUF2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="InterPro:IPR040285"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF2"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ACL55197.1"
FT                   /translation="MSPVTPEDLLAYLADLGIPVRTVAHRPVHTVAESRDLKAGLPGGH
FT                   SKNLFLKDRRGQLFLVVAEAEARIDLKRLHGAIGASGRLSFGSAEQLHAVLGVRPGSVT
FT                   PFGLLNDRDGLVSVILDAALMAHDPVNFHPLHNAATTAIAPGDLIRFLQATGHAPRVMT
FT                   LPEPQPEPEEGRAEISVHS"
     atgagcccgg tcacccctga ggatctcctc gcgtatctcg ccgatctcgg catcccggtg        60
     cgcaccgtcg cgcaccggcc ggtccacacg gtggccgagt cgcgcgatct gaaggccggc       120
     ctgccgggcg gccactcgaa gaacctcttc ctgaaggaca ggcgcggcca gctgttcctg       180
     gttgtggccg aggccgaggc ccgcatcgat ctcaagcgcc tgcatggggc gatcggcgcc       240
     agcggccgtc tgtccttcgg ctcggccgag cagcttcacg ccgtgctcgg cgtccggccg       300
     ggctcggtga cgcccttcgg cctgctcaac gaccgggacg gcctcgtgag cgtgatcctc       360
     gacgccgccc tgatggcgca cgatccggtc aacttccacc cgctccacaa tgcggccacc       420
     accgcgatcg cgccgggcga cctgatccgc ttcctgcagg cgaccggcca cgcgccgcgc       480
     gtgatgaccc ttccggagcc ccagccggag ccggaggagg gcagggcgga gatctccgtc       540
     cacagctga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page