(data stored in ACNUC7421 zone)

EMBL: CP001349.PE146

CP001349.PE146       Location/Qualifiers
FT   CDS_pept        complement(164339..165295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0152"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: met:M446_4607
FT                   pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55198"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF3"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACL55198.1"
FT                   /translation="MTITYADVEAAARRLAGVAHRTPVLTSRTADARTGAKLYFKAEPL
FT                   QRAGAFKFRGAYNAIAALGEAERRRGVLAFSSGNHAQAIAYAGALQGAPTVIVMPHDAP
FT                   AIKVAATEGYGAEVVRYDRYTEDREAVSRRLAEERGLTVIPPYDHPDVIAGQGTAVKEL
FT                   IEETGPLDVILVCLGGGGLLAGSLLSARALAPEAAIYGVEPEAGNDGQMSLARGEIVRI
FT                   PVPVSIADGALTTHLGQHTFPIIRREVTGIVTVSDAQLVAAMRFFVERMKLVVEPTGCL
FT                   AAAAAFEGIVPVAGKRVGVILSGGNVDPAALARFLAA"
     atgacgatca cctatgcgga tgtggaggcg gcggctcgcc gcctcgccgg ggtcgcgcat        60
     cgcacccccg tgctcacctc ccgcacggcc gatgcccgca cgggcgcgaa gctctacttc       120
     aaggccgagc cgctgcagcg cgcgggcgcc ttcaagttcc ggggcgccta caatgccatc       180
     gcggcgctcg gcgaggccga gcggcggcgc ggcgtcctcg ccttctcgtc gggcaaccac       240
     gcgcaggcca tcgcctatgc gggcgcgctc cagggggcgc cgaccgtcat cgtgatgccg       300
     cacgacgcgc ccgccatcaa ggtcgcggcg acggaaggat acggggccga ggtggtgcgc       360
     tacgaccgct acaccgagga ccgcgaggcg gtgagccggc gcctcgcgga ggagcgcggc       420
     ctgaccgtga tcccgcccta cgaccatccg gacgtgatcg ccggccaggg aacggccgtg       480
     aaggagctca tcgaggagac cggccccctc gacgtgatcc tggtctgcct cggcgggggc       540
     gggctgctcg cgggctcgct gctctcggcc cgcgcgcttg cgcccgaggc cgcgatctac       600
     ggggtcgagc cggaggccgg caatgacggg cagatgtcgc tcgccagggg cgagatcgtg       660
     cgcatcccgg tcccggtctc gatcgccgat ggcgcgctca ccacccatct cgggcagcac       720
     accttcccga tcattcgccg cgaggtgacc ggcatcgtca ccgtctcgga cgcccagctc       780
     gttgcggcga tgcgcttctt cgtcgagcgg atgaagctcg tggtcgagcc gaccggctgc       840
     ctcgccgcgg cggcggcctt cgagggcatc gtgccggttg cgggcaagcg cgtcggcgtg       900
     atcctgtccg gcggcaacgt cgatccggcc gcgctcgccc gttttctcgc cgcatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page