(data stored in ACNUC7421 zone)

EMBL: CP001349.PE147

CP001349.PE147       Location/Qualifiers
FT   CDS_pept        complement(165295..166068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0153"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   met:M446_4606 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55199"
FT                   /db_xref="GOA:B8IUF4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF4"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACL55199.1"
FT                   /translation="MEYENIRVETRGRVALITLHRPAQLNALCGPLIAELNAALDGFER
FT                   DEGIGCIILTGSEKAFAAGADIPEMRDRTHPEFFVADPFGEWDRVGRRRKPMIAAVAGY
FT                   ALGGGCELAMMCDFILAADTAKFGQPEIKLGVIPGAGGTQRLTRAVGKAKAMELCLTGR
FT                   LMAAAEAERAGLVARIVPAADLLAEAWQTAETIASMSLPAVMVAKDCVDRAFETTLAEG
FT                   VRYERGLFYGLFATADQKEGMAAFLEKRKPNFEHR"
     gtggaatacg agaacatccg ggtcgagacg cgcgggcggg tggccctcat caccctgcac        60
     cggccggcgc agctcaatgc gctgtgcggg ccgctcatcg ccgagctcaa cgcggcgctc       120
     gacggtttcg agcgcgacga aggcatcggc tgcatcatcc tcaccggctc cgagaaggcc       180
     ttcgcggcag gtgccgacat tccggaaatg cgcgaccgca cccacccgga gttcttcgtc       240
     gccgacccct tcggggaatg ggaccgggtc ggccggcggc gcaagccgat gatcgccgcc       300
     gtcgcgggct acgcgctcgg cggcggctgc gaactcgcca tgatgtgcga cttcatcctg       360
     gccgccgaca ccgccaagtt cggccagccg gagatcaagc tcggggtgat cccgggggcc       420
     ggcggcaccc agcgcctgac ccgggccgtc ggcaaggcca aggcgatgga gctgtgcctc       480
     accgggcgcc tgatggctgc cgccgaggcc gagcgcgccg gcctcgtggc ccggatcgtg       540
     ccggccgccg acctcctggc cgaggcgtgg cagaccgccg agaccatcgc gtcgatgtcg       600
     ctgccggctg tgatggtggc gaaggactgc gtcgaccggg ctttcgagac cacgctggcc       660
     gagggcgtgc gctacgagcg cggcctgttc tacggcctct tcgccaccgc cgaccagaag       720
     gagggcatgg cggccttcct ggagaagcgc aagcccaact tcgagcaccg ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page