(data stored in ACNUC7421 zone)

EMBL: CP001349.PE148

CP001349.PE148       Location/Qualifiers
FT   CDS_pept        complement(166481..167230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0154"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   met:M446_4605 phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55200"
FT                   /db_xref="GOA:B8IUF5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF5"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACL55200.1"
FT                   /translation="MSRLARLPIRSQATALWRRLRLNEVGPLASLLAVSLFGFGFFKVA
FT                   GEVAEGDTKGLDEKLLLALRRPDDLARPIGPGWLPETMRDITAFGSVFGIVYVTACVVL
FT                   YLAGTRRWRAAILVAASVGGGEILSTGLKLFFQRPRPDLVPHGMETFTASFPSGHAMLS
FT                   AVAYLTLAILLARISRGRRVKAFVLALGVVTTLLVGISRVYLGVHWPSDVLAGWCIGAA
FT                   WASLCWFVALQLQRQQVVEAPDPPPPA"
     atgagccggc tcgcgcgcct gccgatccgg agccaggcca ccgccctgtg gcgccgcctg        60
     cgcctcaacg aggtcggccc gctcgcctcg ctcctggccg tgagcctgtt cgggttcggc       120
     ttcttcaagg tggcgggcga ggtcgccgag ggcgacacca agggcctcga cgagaagctg       180
     ctcctggcgc tgcgccggcc cgacgatctc gcccggccga tcgggccggg ctggctgccg       240
     gagacgatgc gggacatcac ggccttcggc agcgtcttcg gcatcgtcta cgtcaccgcg       300
     tgcgtggtcc tctatctcgc gggcacgcgg cgctggcggg cggcgatcct cgtcgccgcc       360
     tcggtcgggg gcggcgagat cctctcgacg gggctcaagc tgttcttcca gcggccgagg       420
     cccgatctcg tgccccacgg catggagacc ttcacggcaa gcttcccgag cggccacgcc       480
     atgctgtcgg cggtggccta tctcaccctg gcgatcctgc tcgcccgcat ctcgcggggg       540
     cggcgcgtga aggccttcgt gctcgcgctc ggagtggtga cgacgctcct cgtcggcatc       600
     agccgggtct atctcggggt gcactggccg agcgacgtgc tcgccggctg gtgcatcggc       660
     gccgcctggg cgtcgctctg ctggttcgtc gccctccagc tccagcgcca gcaggtggtc       720
     gaggcgcccg atccgccgcc gcccgcgtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page