(data stored in ACNUC7421 zone)

EMBL: CP001349.PE15

CP001349.PE15        Location/Qualifiers
FT   CDS_pept        complement(16640..18697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0016"
FT                   /product="peptidase M3A and M3B thimet/oligopeptidase F"
FT                   /EC_number="3.4.15.5"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: met:M446_0011 peptidyl-dipeptidase DCP"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55067"
FT                   /db_xref="GOA:B8IT05"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR034005"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT05"
FT                   /inference="protein motif:PFAM:PF01432"
FT                   /protein_id="ACL55067.1"
FT                   /translation="MAGTTATLPGNPFSEPVWTTPHGLPPFERIEPAHYEPAFTAALAE
FT                   HEAEIAAIADSPEPPSFANTVAALERSGQGLKRVSGVFFNITGSHTNPELQAVERIMAP
FT                   RLARHRSALFLNGALWARVKALDEAGLSEEERRVLDRYRTLFRRAGADLDPAAKERVAA
FT                   ITARLAELGTRFSQNLLADESSFVLPLETEEDLGGLPPFLRAAAARAAAERGLPGHVIT
FT                   LARSLIEPFLVFSTRRDLRERAYTAWIRRGENGGETDNRAIIVETMRLRAERARLLGYE
FT                   TFADFKLADTMAGTPEAAMKLLREVWTPARERAAAERDRLQAMVREEGGNFDLAPWDWR
FT                   HYAEKLRRAEHDLDEGEIKPYLPLDGVIAASFDTASRLFGLSFEELPAFPRYHPDVRAW
FT                   AVKDRDGTTIGLFLGDYFARPSKRSGAWMSAFRSQERLIGPVTPIIVNVMNFAKGGEGE
FT                   PSLLSFDDARTLFHEFGHALHGLLSDVTYPLLAGTAVAGDFVELPSQLYEHWLEQPEVL
FT                   RAHARHYRTGEPMPEALLQRLLAARTFNQGFATVEYTASAIVDLDLHLSRAVEEGLDVN
FT                   AFEAEALRRIGMPAEISMRHRSPHFAHIFTGEGYAAGYYSYLWSEVLDADAFDAFREAG
FT                   DIFDPETARRLRTYVYGAGNLRDAQSAYTAFRGRLPSIEPLLRKRGLLAA"
     atggctggca cgacggcgac tctcccgggc aatccgttct cggagccggt ctggacgacg        60
     ccccacggcc tgccgccctt cgagcggatc gaacccgccc attacgagcc ggccttcacg       120
     gcggcgctcg cggagcacga ggccgagatc gcggcgatcg ccgacagccc ggagccgccg       180
     agcttcgcca acacggttgc ggcgctggag cggtcgggtc aggggctcaa gcgcgtcagc       240
     ggcgtgttct tcaacatcac gggcagccac accaacccgg agctccaggc cgtcgagcgc       300
     atcatggcgc cgcgcctcgc ccggcaccgc agcgcgctct tcctcaacgg agcgctgtgg       360
     gcacgggtca aggcgctcga cgaggcgggc ctgtcggagg aggagcgccg cgtcctcgac       420
     cgctaccgca cgctgttccg ccgcgcgggc gcggatctcg acccggccgc gaaggagcgc       480
     gtggccgcca tcacggcgcg gctcgccgaa ctcggcacgc gtttctcgca gaacctgctg       540
     gccgacgaga gcagcttcgt gctgccgctg gagaccgagg aggatctcgg gggccttccc       600
     cccttcctgc gcgcggccgc ggcgcgggcc gccgccgagc ggggcctgcc gggccacgtc       660
     atcaccctgg cgcgctccct gatcgagccc ttcctggtct tctccacccg gcgcgacctg       720
     cgcgagcgcg cctatacggc ctggatccgc cggggcgaga acgggggcga gaccgacaac       780
     cgcgcgatca tcgtggaaac catgcggctg cgggccgagc gggcgcggct cctcggctac       840
     gagaccttcg cggatttcaa gctcgccgac acgatggcgg gcacgcccga ggccgccatg       900
     aagctcctgc gcgaggtctg gacgcccgcc cgcgagcgcg cggcggccga gcgcgaccgg       960
     ctgcaggcca tggtccggga ggagggcggg aatttcgacc tcgctccttg ggactggcgt      1020
     cactacgccg agaagctgcg ccgggccgag cacgacctcg acgagggcga gatcaagccg      1080
     tacctgcccc tcgacggcgt gatcgcggcg agcttcgaca cggcctcgcg cctgttcggc      1140
     ttgagcttcg aggaactccc ggccttcccc cgctaccatc cggacgtgcg cgcctgggcg      1200
     gtgaaggacc gcgacggcac gacgatcggc ctcttcctcg gcgattactt cgcgcggccg      1260
     agcaagcgct cgggcgcctg gatgagcgcc ttccggtcgc aggagcggct catcggcccg      1320
     gtgacgccga tcatcgtcaa cgtgatgaac ttcgccaagg gtggagaggg cgagccctcg      1380
     ctcctctcct tcgacgatgc ccgcacgctg ttccacgaat tcggccacgc cttgcacgga      1440
     cttctgtcgg acgtcaccta tccgctgctc gccggcacgg ccgtggcggg cgatttcgtc      1500
     gagctgccct cgcagctcta cgagcactgg ctggagcagc ccgaggtgtt gcgggcgcat      1560
     gcgcgccact accgcacggg cgagccgatg ccggaggcgc tgctccagcg gctgctcgcc      1620
     gcccgcacct tcaaccaggg cttcgccacc gtggaataca cggcctcggc cattgtcgac      1680
     ctcgacctgc atctctcgcg cgccgtggag gaggggctcg acgtgaacgc cttcgaggcc      1740
     gaggccctgc ggcggatcgg catgccggcc gagatcagca tgcggcaccg ctcgccgcac      1800
     ttcgcccata tcttcacggg cgagggctat gctgccggtt actattccta tctctggtcg      1860
     gaggtgctgg acgcggatgc cttcgacgcg ttccgggagg cgggcgacat cttcgacccc      1920
     gagacggcgc gccgcctgcg gacctatgtg tacggggcgg ggaacctgcg cgacgcgcag      1980
     agcgcctaca cggccttccg gggccggctg ccgagcatcg agcctctcct gcgcaagcgg      2040
     ggcctgctcg ccgcctaa                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page