(data stored in ACNUC7421 zone)

EMBL: CP001349.PE150

CP001349.PE150       Location/Qualifiers
FT   CDS_pept        167428..168354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55202"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF7"
FT                   /inference="similar to AA sequence:KEGG:M446_4603"
FT                   /protein_id="ACL55202.1"
FT                   /translation="MTHDGNAVHIGRDGWLFLVGGTNQVLRQYRATPWAAWRLWRWQRL
FT                   IERRAARAAALGLRFHQVVVPEKISIYEDRLDGVAIDPALSPARRLGQRMARSPAAGSW
FT                   IDLVGPMRAARDEGRPLYLRTDTHWTERGCQLAHAEIMRGLGAKPRPDLAERPYQDIQA
FT                   VLDLGRKLPSHPVETVRMVHYLRDARRVEANALLETFETQGRAMELHVGARAVFRNDSP
FT                   QADPRRLVLFGDSCAHFGSFFLTALLAESFREVHFLWSASLDWSYVARLRPHLLLVEMA
FT                   ERFLARLPDDRFDSEAVARQKLDRERR"
     atgacccatg acggcaacgc ggttcacatc gggcgggacg gctggctctt cctcgtcggc        60
     ggcaccaatc aggtgctccg tcaataccgg gcgacgccct gggcggcttg gcgcctgtgg       120
     cgctggcagc gtctgatcga gcggcgcgcg gcgcgcgcgg cggcgctcgg cctgcgcttc       180
     catcaggtcg tggtgccgga gaagatcagc atctacgagg atcggctgga cggcgtcgcg       240
     atcgatcccg ccctgtcccc ggcccgccgc ctcgggcagc gcatggcgcg ctcgccggcc       300
     gcgggcagct ggatcgacct cgtcgggccg atgcgcgccg cgcgggacga gggccggccg       360
     ctctacctgc gcacggacac gcattggacc gagcggggct gccagctcgc ccatgcggag       420
     atcatgcggg ggctcggggc aaagccgcgc ccggatctcg ccgagcggcc ctaccaggac       480
     atccaggccg tgctcgacct cggccggaag ctgccgtccc acccggtcga gacggtgcgg       540
     atggtccatt acctgcgcga cgcgcgccgc gtcgaggcga atgcactcct cgaaaccttc       600
     gagacgcagg gccgcgcgat ggaactccat gtcggcgccc gggcggtgtt ccgcaacgac       660
     agcccgcagg ccgatccgcg ccggctcgtc ctgttcggcg attcctgcgc gcatttcggg       720
     tcgttcttcc tcaccgccct cctcgccgag agttttcgcg aggtgcattt cctgtggtcg       780
     gcgagcctcg actggtccta cgtggcgcgg ctgcgcccgc acctgctcct cgtcgagatg       840
     gccgagcgct tcctggcccg cctccccgac gaccggttcg acagcgaggc cgtcgcgcgc       900
     cagaagctcg accgcgagcg ccgctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page