(data stored in ACNUC7421 zone)

EMBL: CP001349.PE151

CP001349.PE151       Location/Qualifiers
FT   CDS_pept        168410..169396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0157"
FT                   /product="glutathione S-transferase domain-containing
FT                   protein"
FT                   /note="KEGG: met:M446_4602 glutathione S-transferase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55203"
FT                   /db_xref="GOA:B8IUF8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF8"
FT                   /inference="similar to AA sequence:KEGG:M446_4602"
FT                   /protein_id="ACL55203.1"
FT                   /translation="MGLLVNGVWQESWYDTRETGGRFVRKESAFRNWVTADGAPGPTGK
FT                   GGFPAEVGRYHLYVSLACPWAHRTLIVRALKGLEEAVSVAVVDPHMGAEGWVFGDTPGA
FT                   GPDTLNGARRLSEIYLKADPGYTGRVTVPVLWDKARGTIVSNESAEIIRMLNGAFGALG
FT                   ATGPDLYPADLREEIDALNAQVYDRVNNGVYKAGFATTQDAYAEAVTALFEELDRLESR
FT                   LDRGRYLFGPRLTEADIRLFTTLVRFDPVYVGHFKCNLRRIADYPNLSGYLRDLYQHPG
FT                   IARTVNLTHIKRHYYESHSTINPTGIVPLGPILDYDAPHGRAGRFAA"
     atggggctgc tcgtcaacgg cgtctggcag gaaagctggt acgacaccag ggagaccggc        60
     ggacgcttcg tgcgcaagga atccgcgttc cgcaactggg tgaccgcgga cggggcgccc       120
     ggccccaccg gcaaaggcgg ctttccggcg gaggtgggcc gctaccacct ctacgtctcg       180
     ctcgcctgcc cgtgggctca ccgcacgctg atcgtgcgtg cgctgaaagg tctggaggag       240
     gcggtctcgg tcgcggtggt cgatccgcat atgggcgccg agggctgggt gttcggcgac       300
     acgcccggcg ccggccccga taccctgaac ggcgcgaggc gcctctccga gatctatctc       360
     aaggccgatc ccggctatac gggccgcgtc accgtgccgg tgctctggga caaggcgcgc       420
     ggcacgatcg tctcgaacga atccgccgag atcatccgga tgctcaacgg ggccttcggc       480
     gccctcggcg ccaccggccc ggacctctac cccgccgatc tgcgcgagga gatcgacgcc       540
     ctcaacgcgc aggtctacga ccgggtcaat aacggcgtct acaaagcggg cttcgcgacg       600
     acccaggacg cctatgcgga ggcggtgacg gccttgttcg aggaactcga tcgcctcgag       660
     tcccgcctcg atcgcggacg ctatctgttc gggccccgcc tgaccgaggc ggatatccgc       720
     ctgttcacca cgctggtccg cttcgatccg gtctatgtcg ggcacttcaa gtgcaacctg       780
     cgccggatcg ccgattatcc gaacctttcg ggctatctgc gcgacctcta ccaacatccg       840
     ggcatcgccc ggaccgtgaa cctgacgcac atcaagcgcc actattacga gagccactcg       900
     accatcaacc cgaccgggat cgtgccgctg gggcccatcc tcgactacga cgcgccgcac       960
     gggcgagctg ggcgcttcgc ggcctga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page