(data stored in ACNUC7421 zone)

EMBL: CP001349.PE152

CP001349.PE152       Location/Qualifiers
FT   CDS_pept        169590..169802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0158"
FT                   /product="ferredoxin protein"
FT                   /note="KEGG: met:M446_4601 ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55204"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF9"
FT                   /inference="similar to AA sequence:KEGG:M446_4601"
FT                   /protein_id="ACL55204.1"
FT                   /translation="MRVVVDLNRCQAYAQCCFAAPDSFALHGIEVLVYDPAPPPERRRE
FT                   IERAVQACPVRAIMLEVEPEAERHD"
     atgcgcgtcg tcgtcgacct gaaccgctgc caagcctatg cccagtgctg ctttgcggcg        60
     cccgacagct tcgcgctgca tggcatcgag gtgctggtct acgatccggc tccgccgccg       120
     gagcgacgcc gggagatcga gcgggcggtc caggcctgcc ccgtgcgggc gatcatgctg       180
     gaggtcgagc cggaggccga gcgccatgac tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page