(data stored in ACNUC7421 zone)

EMBL: CP001349.PE153

CP001349.PE153       Location/Qualifiers
FT   CDS_pept        169795..171093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0159"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: met:M446_4600 cyclic
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55205"
FT                   /db_xref="GOA:B8IUG0"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG0"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACL55205.1"
FT                   /translation="MTEPGMTEPGRTVIVGASLAGLRAAEALRHGGHRGPITLVGDEPY
FT                   LPYDRPPLSKRVLTGEERPDQITLPSRPGLDLSWRLGAAAVGLDLTAREVALATGDRIA
FT                   FDTLLIATGTRARPWPKPEEAALKGVHAIRHRDDAERLRRALAASPRRVLIIGAGFIGC
FT                   ESASACRAIGLPVTVIDPNPTPLASVLGTRIGSVVAGMLGRAGVDYRPSTRVEALEADA
FT                   EGRVRAARFVGGGAIEADIVIVALGAVRNTEWLTGSGIAADPGGVSCDGFCRVLDRAGQ
FT                   PVDGVVAAGDVARFPHPLIENGPVAFEHWGHAVAQAAHAARTLLGRHDRPYAELPAFWS
FT                   TQFDVNIKSVGLTNGADSVAVTQGSLAERRFVAVYGRAGRTVAAISFDSTRWLPAYAAR
FT                   IEARDAFPPILGATDQGRVAPADPGFPSRPARA"
     atgactgagc ccgggatgac cgagcccggg cggaccgtga tcgtcggcgc ctcgctggcg        60
     gggcttcgcg ccgcggaggc cctgcggcac gggggccatc gcggtccgat caccctggtg       120
     ggcgacgagc cctacctccc ctatgaccgg ccacccctgt cgaagcgcgt gctcaccggg       180
     gaggagcgcc ccgaccagat caccctgccg tcgcgcccgg gcctcgatct tagttggcgg       240
     ctcggcgccg ccgccgtcgg gctcgatctc acggcccgcg aggtggcgct ggcgacgggt       300
     gaccggatcg ccttcgacac gctgctgatt gccaccggca cccgggcgcg gccctggccg       360
     aagccggagg aagccgccct caagggcgtc cacgcgatcc gccaccggga cgatgccgag       420
     cgcctgcgcc gggccctcgc cgcctcgccg cggcgggtgc tgatcatcgg ggcgggcttc       480
     atcggctgcg agtcggcctc cgcctgccgc gcgatcggcc tgcccgtgac ggtgatcgat       540
     cccaatccga cgccgctcgc ctcggtgctc ggcacgcgga tcggtagcgt cgtcgccggg       600
     atgctgggcc gagcgggtgt cgattaccgt ccgtccacgc gcgtggaggc gctggaggcg       660
     gatgcggagg gccgggtccg cgcggcccgc ttcgtcggcg gcggcgcgat cgaggccgac       720
     atcgtcatcg tggccctcgg ggcggtgcgc aacaccgagt ggctcaccgg atccggcatc       780
     gcggcggatc ccggcggcgt ctcctgcgac ggcttctgcc gcgttctcga ccgggcgggc       840
     cagccggtcg acggcgtggt cgcggcgggc gacgtcgcgc gcttccccca cccgctcatc       900
     gagaacggac ccgtcgcctt cgagcattgg ggccatgcgg tcgcccaggc cgcgcatgcg       960
     gcccgcacgc tgctcggccg tcacgaccgg ccctatgccg agcttccggc cttctggtcg      1020
     acccagttcg acgtgaacat caagtcggtc ggcctgacga acggcgccga cagcgttgcg      1080
     gtcacgcagg gcagcctcgc cgagcgccgc ttcgtggcgg tctacggccg ggccggacgc      1140
     acggtggcgg caatctcttt cgattcgacc cgctggctcc cggcctatgc ggcccgcatc      1200
     gaggcccgcg acgcctttcc cccgatcctc ggcgcgacgg accagggccg cgtcgccccc      1260
     gccgatcccg gtttcccgtc ccgtccggcg cgagcctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page