(data stored in ACNUC7421 zone)

EMBL: CP001349.PE154

CP001349.PE154       Location/Qualifiers
FT   CDS_pept        171099..172340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0160"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: met:M446_4599
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55206"
FT                   /db_xref="GOA:B8IUG1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG1"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACL55206.1"
FT                   /translation="MPDPNLFAAVKDPANRPNPYPLYARLRETPVALQHDGSYVVTTHA
FT                   ALRALVFDPRLSSEDLPPISHPRTGNPFKDWIVNPIKDYVRTKHRPFIFRDPPDHDVLR
FT                   RHVTRQFTPERLRTMHGRVDALVADLLDRCRDARTIDLVDHFSYPLPVMVICELLGVPH
FT                   EDEPRFHGWATQLATALEPDAREDEETKGRNIETFDVIAAYMQDLIREKRRHPQDDLLT
FT                   GLATYEDPKVGRMGDYDLIATAILLLIAGHETTVNLITNGMLTLLRFPEHLERLRADPE
FT                   IAPRLIEELLRYEPPVHFRTRKALADIRMEGVTIPQGAPIVLLFASGSRDPARFPDPDR
FT                   FDPDREDNQHFGFGGSLHFCVGAPLARMEAEAALVALAQRLRNPRLIEDPPPYRPGASL
FT                   RGPQHLRLAIEGVA"
     atgcccgatc cgaacctgtt cgccgcggtc aaggacccgg ccaaccgccc gaatccctat        60
     ccgctctacg cgcgcctgcg cgagacgccg gtcgcgctcc agcacgacgg cagctacgtg       120
     gtgacgaccc acgcggcttt gcgcgccctc gtcttcgacc cccgcctcag ctccgaggat       180
     ctgccgccca tctctcatcc gcgcaccggc aatcccttca aggactggat cgtcaacccg       240
     atcaaggact acgtgcggac caagcaccgg cccttcatct tccgcgaccc gcccgaccac       300
     gacgtgctgc gccgccacgt gacgcgccag ttcacgcccg agcggctgcg gacgatgcac       360
     gggcgggtcg atgccctcgt cgccgacctg ctcgaccgct gccgcgatgc ccgcacgatc       420
     gacctcgtgg accacttctc ctatccgctc cccgtcatgg tgatctgcga actcctgggc       480
     gtaccgcacg aggacgagcc gcgcttccac ggctgggcga cgcagctcgc gaccgccctc       540
     gagcccgatg cccgcgagga cgaagagacc aagggccgca acatcgagac cttcgacgtg       600
     atcgccgcct acatgcagga tctcatcagg gagaagcggc ggcatccgca ggacgacctc       660
     ctgaccgggc tcgcgaccta cgaggacccg aaggtcggcc ggatgggcga ctacgacctg       720
     atcgcgacgg cgatcctcct cctcatcgcg ggccacgaga ccacggtgaa cctgatcacc       780
     aacggcatgc tgacgctcct gcgcttcccc gagcatctgg agcggctgcg ggcggatccg       840
     gagatcgcgc cccggctgat cgaggagctt ctgcgctacg agccgccggt ccatttccgc       900
     acccgcaagg cgctggccga catccgcatg gagggggtga cgatcccgca aggcgccccc       960
     atcgtgctgc tcttcgcctc tggcagccgc gatccggccc ggtttcccga ccccgaccgc      1020
     ttcgaccccg atcgcgagga caaccagcat ttcggcttcg gcggcagcct gcatttctgc      1080
     gtcggcgcgc cgctcgcacg catggaggcc gaggcggcgc tcgtcgccct ggcgcaacgg      1140
     ctgcgcaacc cccgtctgat cgaggatcct ccgccctacc ggcccggcgc ttccttgcgc      1200
     gggccgcagc atctgcggct cgccatcgag ggggtcgcct ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page