(data stored in ACNUC7421 zone)

EMBL: CP001349.PE155

CP001349.PE155       Location/Qualifiers
FT   CDS_pept        complement(172544..174295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0161"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; Patatin; KEGG:
FT                   met:M446_4598 cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55207"
FT                   /db_xref="GOA:B8IUG2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG2"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACL55207.1"
FT                   /translation="MDIVDGATHPEIPFLAPLDLATAAAVRERLEPIAVAGGQILFEQD
FT                   APADALYALVSGAIGISARDPASGEMRPVARVRPPETVGEMALLSGEPRSATATVLRDS
FT                   YLLRLSKSAFDDLVECHPATMLYFARLLAARLRSVSSQQPLATAPMTFAVIGVTEGVEA
FT                   AGFASAFAAALPGRSTALATWPEEADETWFHALETAHDQVVYAAEAPGSGWANLCLRRA
FT                   DHVLLLAAPRHPPRGALAGRIVMPVPGWTRQDLVVLNAQGATRPGPLDPAVTALPVALR
FT                   LQARAGNAQDLARIARLAGGRARGLVLGGGGARGFAHLGVMRALAEAGLAVDLVAGTSM
FT                   GAVTGASLAMGWDLEEIVAHTVAAFVESSPLNDYTLPITALTRGAKVDRRLALHFGDAR
FT                   IEDLWLPFFCVSSNLTTGAAMVHREGPLVPALRASIAIPGLLPPVLDAEGVLVDGGVMN
FT                   NLPADLMAALGRGTVLAVDVASDLALDTMPRRSLRSRVLRRALGVPFAMPSIAQILLRA
FT                   ATVSSDASAAMARDRATAVLRPPLAGIDLRAWRSYAAVAEIGYRDARARLAEGALDAWA
FT                   AGMAAVR"
     atggatatcg tggacggggc gacacatccg gagatcccgt tccttgcccc gctcgacctc        60
     gcgacggccg ccgccgtgcg cgagcggctc gaaccgatcg cggtcgcggg cgggcagatc       120
     ctgttcgagc aggatgctcc cgccgatgcg ctctacgcgc tcgtctccgg cgcgatcggg       180
     atttcggccc gcgacccggc gagcggcgag atgcgccccg tcgcccgggt gcgcccgccg       240
     gaaaccgtgg gcgagatggc cctcctctcc ggcgagccgc gctcggccac cgcgacggtg       300
     ctgcgcgatt cctacctcct gcgcctgtcg aagtcggcct tcgacgatct cgtggagtgc       360
     catccggcga ccatgctgta tttcgcccgg ctcctggcgg ccaggctgcg cagcgtctcc       420
     tcgcagcagc cgctcgccac cgcgccgatg accttcgcgg tgatcggcgt gaccgagggc       480
     gtcgaggccg cgggctttgc cagcgccttc gcggcggcgc tgcccggccg ctccaccgcg       540
     ctcgccacct ggcccgagga ggcggacgag acctggttcc acgccctcga gaccgcgcat       600
     gatcaggtcg tctacgcggc cgaggcgccg ggctccggct gggcgaatct ctgcctgcgc       660
     cgggccgatc acgtcctgct gctcgccgca ccgcgccatc cgccgcgggg agcgctcgcc       720
     ggccgcatcg tcatgccggt gccgggctgg acgcgacagg atctcgtcgt cctcaacgcg       780
     cagggcgcga cgcgcccagg cccgctcgat ccggccgtga cggccctgcc ggtcgccctg       840
     cggctccagg cgcgcgcggg caacgcgcag gatctggccc ggatcgcgcg gctcgccggc       900
     gggcgcgcgc gcggcctcgt gctcggcggc gggggcgcgc gcggcttcgc gcatctcggg       960
     gtgatgcgtg cgctggcgga ggccgggctc gccgtcgacc tcgttgccgg caccagcatg      1020
     ggcgccgtca cgggtgcgag cctcgcgatg ggatgggacc tggaggagat cgtggcccat      1080
     acggtcgcgg cctttgtcga gagctcgccc ctcaacgact acacgctgcc gatcaccgcg      1140
     ctcacccgcg gcgccaaggt cgaccgcagg ctcgcgctgc atttcggcga tgcccggatc      1200
     gaggatctct ggctgccctt cttctgcgtg tcgtcgaacc tgaccaccgg cgcggcgatg      1260
     gtccatcgcg agggtccgct cgtcccggcc ctgcgcgcca gcatcgcgat cccggggctg      1320
     ctgccgccgg tgctcgatgc cgagggggtg ctcgtcgatg gcggggtcat gaacaacctg      1380
     ccggccgacc tgatggcggc gctgggccgc ggcacggtgc tcgccgtgga cgtcgcgagc      1440
     gatctcgccc tcgacaccat gccccggcgc agcctgcgct cgcgggtgct gcgccgggcg      1500
     ctgggcgtgc ccttcgcgat gccgagcatc gcccagatcc tgctgcgcgc ggccacggtg      1560
     tcgagcgacg cctcggccgc catggcccgg gaccgggcga ccgcggtgct gcgtccgccc      1620
     ctcgccggca tcgacctgcg ggcgtggcgc agctacgcgg cggtggccga gatcggctac      1680
     cgcgacgccc gcgcgcggct ggcggaaggg gcgctcgacg cctgggccgc cgggatggcg      1740
     gccgtccggt ag                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page