(data stored in ACNUC7421 zone)

EMBL: CP001349.PE156

CP001349.PE156       Location/Qualifiers
FT   CDS_pept        complement(174342..175523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55208"
FT                   /db_xref="InterPro:IPR021445"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG3"
FT                   /inference="similar to AA sequence:KEGG:M446_4597"
FT                   /protein_id="ACL55208.1"
FT                   /translation="MAAGTMSRVGGGDGSGAGFRYAAIAPITDFQRVLDESVYRPVPDA
FT                   WWVAMTDVVESTAAIAAGRYKAVNFAGAAAIAALRNALRGRDIPFVFGGDGASLLLAPD
FT                   EVETARAALAATVAWVRAEMGLTLRAALVPVSAIREAGCDLQVARYAPSPHVAYAMMTG
FT                   GGLAFAERALKRGLYAVPPADGARPDLTGLSCRFSPARARHGMVLSVIVVGAEGADPGA
FT                   TRAVIAEVLRLVAAAPAMGRPLPEGGPPLRWPPEGLAHEVRAGGAPRGLRRIALLLRTL
FT                   AALLIFRLHVPVGRFSPDRYLCELVANADFQKYDDGLRMTLDCDAATADAIEARLRAAE
FT                   AAGLVRYGLHRQAAALTTCITPVPSESNHVHFIDGEDGGYTRAARMLKAKAAA"
     atggcggcgg gcacgatgtc gagggtcggg gggggcgacg gatcaggggc cggcttccgc        60
     tacgccgcca tcgcgcccat caccgacttc cagcgcgtcc tcgacgagtc cgtctaccgg       120
     ccggtgccgg atgcatggtg ggtcgccatg acggatgtgg tcgagtcgac cgccgccatc       180
     gcggccggcc gctacaaggc ggtcaacttc gccggggccg ccgccatcgc ggctttgcgc       240
     aacgccctcc ggggccgcga cattcccttc gtgttcggcg gcgacggggc gagcctcctt       300
     ctcgcgccgg acgaggtcga gaccgcccgc gcggcgctcg ccgccaccgt ggcctgggtc       360
     cgggccgaga tgggcctgac cctccgggcc gctctggtcc cggtctcggc gatccgggag       420
     gccggttgcg atctgcaggt ggcccgctac gccccgtcgc cgcacgtggc ctacgcgatg       480
     atgaccggcg ggggactggc cttcgcggag cgcgccctga aacgggggct ctacgcggtg       540
     ccgccggcgg acggggcccg cccggacctg accggcctct cctgccgctt ctcgccggcc       600
     cgcgcccgcc acgggatggt cctctcggtc atcgtcgtcg gggcagaggg ggccgatccg       660
     ggcgccacgc gggccgtgat tgcggaggtg ctccggctcg tcgccgcggc ccccgccatg       720
     ggacgcccgc tgcccgaggg cgggccgccc ctgcgctggc cgccggaggg ccttgcccac       780
     gaggtgcggg cgggcggggc gccgcggggc ctgcgccgga tcgcgctcct gctgcgcacc       840
     ctggccgcgc ttctcatctt ccgcctgcac gtcccggtcg gccgcttctc gcccgaccgc       900
     tacctgtgcg aactcgtcgc taatgcggat ttccagaaat acgacgatgg cctgcgcatg       960
     acgctcgact gcgacgcggc gacggcggac gcgatcgaag cgcggctcag ggcggccgag      1020
     gcggccgggc tcgtccgcta cggcctccac cggcaggcgg cggcgctcac gacctgcatc      1080
     acgccggtgc cgagcgagag caaccacgtg catttcatcg acggggagga tggcggctac      1140
     acccgcgcgg cgcggatgct gaaggccaag gccgccgcgt ag                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page