(data stored in ACNUC7421 zone)

EMBL: CP001349.PE157

CP001349.PE157       Location/Qualifiers
FT   CDS_pept        complement(175600..177009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0163"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: rle:pRL110185 putative transmembrane adenylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55209"
FT                   /db_xref="GOA:B8IUG4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG4"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55209.1"
FT                   /translation="MTGAISLGRLLAELGTLRAVDASGRMRRVLRQQEDAGLAFAFRAR
FT                   QAAILVVSLWLLFLVPTPRDLYYLAFAALFFGLGWIPFRLRRHRRALAIKLGFILLDAV
FT                   LVTLVVVLPPPAELGVDWPIQTRLRAVEYLYLLLLLGEASLSYSPLAVVWTGFSIMGAW
FT                   SVAVVAVYCRPDTVRYRDVVAQLGPLSDEMALKTVFDPRYVGLTPWWTQMVLTALLTSL
FT                   LACAVARARATLLARVRGEVARADLARYVSPDVADALTATAHSGFGAPRERVVAVLFAD
FT                   LVGFTTLAERLQPETVLALLKAFRERSCRIVFAHGGTLDKFLGDGFMATFGCLEDEPDA
FT                   PHTALACALALQEEMARWNAEREAAGQPCVALSIGLHCGPVVVGTIGAQQRVEFTVVGD
FT                   VVNVASRLQQATRDLGGGIVASEGCLAAAIDAGLALDGFGDSRELTLRGRSQPIRVRVW
FT                   TGHPPTVPRPA"
     gtgaccgggg ccatctctct cggccggctc ctcgccgaac tgggcacgct gcgagcggtc        60
     gatgcgtccg gccgcatgcg gcgcgtgctg cgccagcagg aggatgcggg cctcgccttc       120
     gcgttccggg cccggcaggc cgccatcctg gtggtgtcgc tctggctcct cttcctcgtt       180
     ccgacgccgc gcgacctcta ttatctcgcc ttcgcggccc tgttcttcgg cctcggctgg       240
     atcccgttcc ggctgcgccg ccaccggcgc gcgctcgcga tcaagctcgg cttcatcctg       300
     ctcgacgccg tgctggtcac gctcgtcgtg gtgctgccgc cgcccgccga gctcggcgtc       360
     gactggccga tccagacccg cctgcgcgcg gtggaatacc tctacctcct gctgctgctc       420
     ggcgaggcga gcctgtccta ttcgccgctc gcggtcgtct ggaccggatt ctcgatcatg       480
     ggggcgtggt cggtcgccgt cgtggcggtc tattgtcggc ccgacacggt gcgctaccgc       540
     gacgtcgtcg cgcagctcgg cccgctctcg gacgagatgg cgctcaagac ggtgttcgat       600
     ccgcgctatg tcgggctcac cccttggtgg acccagatgg tgctgacggc cctgctcacc       660
     agtctcctgg cctgtgcggt ggcgcgggcc cgggcgacgc tgctggcgcg ggtgcggggc       720
     gaggtggcgc gcgcggatct cgcccggtac gtgtcaccgg acgtggccga tgcgctcacc       780
     gccacggcgc attccggctt cggtgcgccg cgcgagcggg tggtcgcggt gctctttgcc       840
     gacctcgtgg gcttcaccac gctggcggag cggctccagc cggagacggt cctggcgctg       900
     ctcaaggcgt tccgcgagcg gagctgccgc atcgtcttcg cgcatggcgg caccctcgac       960
     aagttcctgg gcgacggctt catggcgacc ttcggctgcc ttgaggacga accggacgcg      1020
     ccgcatacgg cgctcgcctg cgcgctggcg ctgcaggagg agatggcgcg ctggaatgcc      1080
     gagcgcgagg cggcgggcca gccctgcgtc gccctctcga tcggcctgca ttgcgggccg      1140
     gtcgtcgtcg ggacgatcgg tgcgcagcag cgcgtcgagt tcaccgtggt gggcgatgtc      1200
     gtgaacgtgg cgagccggct tcagcaggcg acccgcgacc tcggcggcgg catcgtggcc      1260
     tcggaaggat gcctcgcggc agccatcgat gccggcctcg ccctcgacgg cttcggcgac      1320
     agccgcgaac tcaccctgcg cgggcgcagc cagccgatcc gggttcgggt ctggaccggg      1380
     catccgccga cggttccccg gccggcgtga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page