(data stored in ACNUC7421 zone)

EMBL: CP001349.PE159

CP001349.PE159       Location/Qualifiers
FT   CDS_pept        complement(177547..177852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55211"
FT                   /db_xref="GOA:B8IUG6"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG6"
FT                   /inference="similar to AA sequence:KEGG:M446_4594"
FT                   /protein_id="ACL55211.1"
FT                   /translation="MNPTAEAWDARVDRLTERLPERGQRWLAWLRAPSRRWIRIPAAFL
FT                   LVLGGFLSILPVLGLWMLPLGLALLSEDWPVLKVPLEHAARGIERLWRKVFPDRTA"
     ttgaacccga ccgccgaagc ctgggatgcc cgcgtcgacc gtctgaccga gcggctgccg        60
     gagcgcgggc agcgctggct cgcatggctg cgcgcgccct cgcggcgctg gatccgcatc       120
     ccggcggcct tcctgctggt cctcggcggc ttcctgtcga tcctgccggt tctcggcctg       180
     tggatgctgc cgctcggcct cgcgctcctg agcgaggatt ggccggtcct caaggtgccc       240
     ctcgagcacg ccgcccgcgg gatcgaacgc ctctggcgga aggtttttcc cgatcgcaca       300
     gcgtga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page