(data stored in ACNUC7421 zone)

EMBL: CP001349.PE16

CP001349.PE16        Location/Qualifiers
FT   CDS_pept        18830..19576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0017"
FT                   /product="Extensin family protein"
FT                   /note="PFAM: Extensin family protein; KEGG: met:M446_0012
FT                   extensin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55068"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT06"
FT                   /inference="protein motif:PFAM:PF06904"
FT                   /protein_id="ACL55068.1"
FT                   /translation="MLIRHPVLLAALLLARPAVAEVPLPPPRPDRPPPAAEPAPSPLEP
FT                   APTPAPLPPERPAELPAGPVTPVVPDDTACLRRLDRLGVKAEPLPPLSDGLCGAPKPLR
FT                   VTELPDGVLVSPAATLTCQATEALARWSTEVRVLAERGLGYAPRSVRIATSYECRGQNR
FT                   DPEAKLSEHAFANAVDIVGFTFEGRDPVTIGTEADGTPEAAFQAAVQAKACAFFRTVLG
FT                   PGSDAAHGNHLHLDERERPAGHRLCQ"
     atgctgattc gtcatcctgt cctcctcgcc gccctgcttc tggcccggcc cgcggtggcc        60
     gaggtgccgc tcccgccgcc gcgccccgat cggccgccgc cggcggccga gcccgccccg       120
     tctcccctcg agcccgcccc cacgcctgcc cccttgccgc ccgaacgacc cgccgagctg       180
     cccgccggtc cggtgacgcc ggtggtgccg gacgacaccg cctgcctgcg tcggctcgac       240
     cgcctcgggg tcaaggccga acccctgccg ccgctctcgg acgggctctg cggcgcgccg       300
     aagccgctcc gggtcaccga actgccggac ggtgtcctgg tctcgcccgc agccaccctc       360
     acctgccagg ccaccgaggc gctcgcccgg tggagcacgg aggtgcgtgt cctcgccgag       420
     cgggggctcg gctatgcccc ccgctccgtc cgcatcgcca cctcctacga gtgccgcggc       480
     cagaaccgcg acccggaggc caagctgagc gagcacgcct tcgcgaacgc cgtcgacatc       540
     gtgggcttca ccttcgaggg ccgcgatcca gtgacgatcg ggacagaagc ggacggcacg       600
     cccgaggcgg ccttccaggc ggcggtgcag gcgaaggcct gcgccttctt ccgcaccgtg       660
     ctcgggcccg gatcggatgc cgcgcacggc aaccacctcc atctcgacga gcgcgagcgc       720
     ccggccgggc accggctttg ccaatga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page