(data stored in ACNUC7421 zone)

EMBL: CP001349.PE160

CP001349.PE160       Location/Qualifiers
FT   CDS_pept        177952..179169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0166"
FT                   /product="protein of unknown function DUF482"
FT                   /note="PFAM: protein of unknown function DUF482; KEGG:
FT                   met:M446_4593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55212"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG7"
FT                   /inference="protein motif:PFAM:PF04339"
FT                   /protein_id="ACL55212.1"
FT                   /translation="MESGGQAASGPASPDALTVRVVPRIAEIPAAEWDRCALSRESLAG
FT                   TGESHNPFVTHAFLSALEEAGCVSGRAGWLPLHLAVERAGRLVGVAPCYLKSHSRGEYV
FT                   FDHGWADAYARAGGDYYPKLQVSVPFTPVTGPRLLLAPGEPAEEAIAALIAGLRALRRE
FT                   TKASSIHVTFMPEAQWAAAGRLGFLQRVDQQFHWDNQGYGSFEAFLGALASRKRKAVKR
FT                   ERRDALASGVTVEWVTGSDLTEAHWDAFFRFYMDTGSRKWGRPYLNRRFFSLLGERMPE
FT                   RVLLVMARRQGRYVAGALNLIGDTALYGRNWGCIEDHPFLHFEVCYYQAIDFAIARGLA
FT                   RVEAGAQGEHKLARGYRPVVTHSAHDIADPGLRAAIADYLRREAGYVRQALCEYEASTP
FT                   YRQGEE"
     atggagagcg gcggacaagc ggcaagcggc ccggcctcgc cggacgccct gacggtgcgc        60
     gtcgtgccgc ggatcgccga gatcccggcg gcggagtggg accgctgcgc cctctctcgg       120
     gaatcgctcg cgggcaccgg cgagagccat aatcccttcg tcacgcatgc cttcctgtcg       180
     gcgctggagg aggcgggctg cgtctccggc cgcgccggct ggctgccgct ccacctggcg       240
     gtcgagcgcg ccggccgcct cgtcggcgtg gccccctgct acctgaagtc ccattcgcgg       300
     ggcgaatacg tcttcgacca cggctgggcc gacgcctatg cccgggccgg gggcgattac       360
     tacccgaagc tccaggtcag cgtgccgttc acgccggtga cggggccgcg cctcctcctc       420
     gcgcccggcg agcccgccga ggaggccatt gcggcgctca tcgccggtct tcgggccctg       480
     cgccgggaga ccaaggcctc ctcgatccac gtcaccttca tgccggaggc gcaatgggcg       540
     gcggccggcc ggctcggctt cctgcagcgc gtcgaccagc aattccattg ggacaaccag       600
     ggctacggga gcttcgaggc gttcctcggc gcgctggcct cccgcaagcg caaggccgtg       660
     aagcgggagc ggcgcgacgc gctcgcgagc ggcgtcacgg tggaatgggt gaccggctcc       720
     gacctgacgg aggcgcattg ggacgccttc ttccgcttct acatggatac cggctcgcgc       780
     aaatggggcc ggccctatct caaccggcgc ttcttctcgc tcctcggcga gcgcatgccg       840
     gagcgcgtgc ttctggtgat ggcgcggcgg cagggccgct atgtggcggg ggcgctcaac       900
     ctgatcggcg acacggcgct ctacgggcgc aactggggct gcatcgagga ccatcccttc       960
     ctgcatttcg aggtctgcta ttatcaggcg atcgacttcg ccatcgcccg cggcttggcc      1020
     cgcgtggaag ccggcgcgca gggcgagcac aagctcgcgc gcggctaccg gccggtggtg      1080
     acgcattccg cccacgacat cgccgatccg gggctgcgcg cggccatcgc cgactatctc      1140
     cgccgcgagg ccggctatgt gcggcaggcc ctgtgcgagt acgaggccag caccccgtac      1200
     cggcagggcg aggagtga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page