(data stored in ACNUC7421 zone)

EMBL: CP001349.PE161

CP001349.PE161       Location/Qualifiers
FT   CDS_pept        179441..180400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55213"
FT                   /db_xref="GOA:B8IUG8"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG8"
FT                   /inference="similar to AA sequence:KEGG:M446_4592"
FT                   /protein_id="ACL55213.1"
FT                   /translation="MAEAERARLEPMTVSSAPSVGLAAVILAATQDEPRVLTVPVPDQP
FT                   PGRGEGLPSGPLEPAHPTLERGLRAWVERQTGQTLGYVEQLYTFGDRNRRPGGDGQHAL
FT                   SVAYLALAREARPTADSAWQNWYRYFPYEDWRTGRPGSLDAIAARLDAWARAAPDSGER
FT                   RRRLDRIGLTFGVAGGGWNEERVLERYELLFEAGLVPEAGAPDPLAGQPMALDHRRMLA
FT                   TALGRLRGKIKYRPVVFELMPPTFTLGQLQRVVEALSGVLLHKQNFRRLVAQQGLVEET
FT                   DAISAETGGRPARLMRFRREVLLERPAPGVRLPPGRRL"
     atggcggagg cggagcgggc gcggctggag ccgatgacgg tctcgtcggc gccttcggtc        60
     ggccttgccg ccgtgatcct cgcggcgacg caggacgagc cgcgcgtcct cacggtgccg       120
     gtcccggacc agccgcccgg ccgcggcgag ggcctcccct ccggcccctt ggagccggcc       180
     catcccaccc tggagcgggg cctgcgcgcc tgggtcgagc gccagaccgg acagacgctc       240
     ggctatgtcg agcagctcta caccttcggc gaccgcaacc gccgccccgg cggcgacggg       300
     cagcacgcgc tctccgtcgc ctatctggcc ctggcgcggg aagcgcgccc caccgccgat       360
     tcggcctggc agaactggta ccgctacttc ccctacgagg actggcggac cggacgcccg       420
     ggttccctcg acgccatcgc ggcccggctc gatgcctggg cgcgcgccgc gcccgattcg       480
     ggcgagcgcc gccgccggct cgaccggatc ggcctcacct tcggcgtcgc gggcggcggc       540
     tggaacgagg agcgcgtgct ggagcgctac gaactcctgt tcgaggccgg gctcgtgccg       600
     gaggcgggcg cgccggatcc cctcgcgggc cagcccatgg cgctcgacca tcgccgcatg       660
     ctcgcgaccg ccctcggccg cctgcggggc aagatcaagt accggccggt cgtgttcgag       720
     ctgatgccgc cgaccttcac cctcggccag ctccagcggg tggtcgaggc gctctcgggc       780
     gtgctcctgc acaagcaaaa tttccgccgc ctcgtcgccc agcagggcct ggtcgaggag       840
     accgatgcga tcagcgccga gaccggcggg cgccccgccc ggctgatgcg cttccgccgc       900
     gaggtgttgc tcgaacgccc ggcgcccgga gtgcgcctgc cgcccgggcg tcgcctctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page