(data stored in ACNUC7421 zone)

EMBL: CP001349.PE162

CP001349.PE162       Location/Qualifiers
FT   CDS_pept        181196..182197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0168"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: met:M446_4591
FT                   quinolinate synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55214"
FT                   /db_xref="GOA:B8IUG9"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG9"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ACL55214.1"
FT                   /translation="MAAVTQAVQEALPLPDLYARVKGHVPAIEWPALAEDVAAIQMLKR
FT                   QRNAVVLAHNYQAPEIFHTVADIVGDSLALAREAARTDADVIVLAGVHFMAETAKLLNP
FT                   EKTVLIPDQAAGCSLADSITAADVRALRRSHPGVPIVTYVNTSAAVKAESDLCCTSGNA
FT                   KAVVESLGVPRVLMIPDEYLARNVQAELPQVEILSWAGHCEVHERFSPADIREVREAYP
FT                   GVTVLAHPECPPEVVAEADFAGSTAAMQDFVETRRPAQVVMITECSMADNLAVRNPEVA
FT                   FVKPCNLCPHMKRISLSKIRRALETMTHEVTVPSDLIAPARRAVERMLAVRP"
     atggctgcgg tgacccaagc ggtgcaggag gcgctgcccc tgccggatct ctatgcccgg        60
     gtgaagggcc atgttccggc gatcgaatgg ccggccctcg ccgaggacgt ggcggcgatc       120
     cagatgctga agcggcagcg caatgccgtg gtgctcgccc acaattatca ggcgcccgag       180
     atcttccaca cggtggcgga catcgtcggc gacagcctcg cgctcgcccg cgaggccgcg       240
     cgcaccgacg cggacgtgat cgtgctcgcg ggcgtgcact tcatggccga gaccgcgaag       300
     ctgctgaacc cggagaaaac cgtgctgatt cccgatcagg cggccggctg ctcccttgcg       360
     gattcgatca cggcggcgga tgtgcgggcg ctccgccgca gccatccggg cgtgccgatc       420
     gtcacctacg tcaacacctc ggcggcggtg aaggccgagt ccgatctctg ctgcacctcc       480
     ggcaacgcga aggcagtggt cgagtccctc ggcgtaccgc gcgtgctgat gatcccggac       540
     gagtacctcg cccgcaacgt gcaggccgag ctgccgcagg tcgagattct gtcctgggcc       600
     ggccattgcg aggtgcacga gcgcttctcg cccgcagaca tccgcgaggt gcgcgaagcc       660
     tatccgggcg tgacggtgct ggcccacccc gaatgcccgc ccgaggtggt ggccgaagcg       720
     gatttcgccg gatcgacggc ggcgatgcag gatttcgtcg agacccgccg cccggcgcag       780
     gtggtgatga tcaccgaatg ctcaatggcc gacaatctcg cggtccgcaa tccggaggtg       840
     gcattcgtca agccctgcaa tctctgcccg catatgaagc gcatctcgct gtccaagatc       900
     cggcgggcgc tcgaaaccat gacccacgag gtcacggtgc cctccgacct gatcgccccc       960
     gcgcgccggg cggtcgaacg gatgctggcg gtgcggccgt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page