(data stored in ACNUC7421 zone)

EMBL: CP001349.PE163

CP001349.PE163       Location/Qualifiers
FT   CDS_pept        182194..183693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0169"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /EC_number="1.4.3.16"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: met:M446_4590
FT                   L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55215"
FT                   /db_xref="GOA:B8IUH0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUH0"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ACL55215.1"
FT                   /translation="MSADRTLVVGAGVAGLATALRLAPLPVTLLTGAPLGEGTATAWAQ
FT                   GGIAAAIGPDDDPALHAADTRAAGAGLTDPDVAQRVAEAGPGLVAWLSALGLAFDRGPD
FT                   GALALGLEAAHGRRRIVKAGGDATGRAVLQTLARASAASPSISVVVGQATALAQDANGR
FT                   VAGLRACVNGASVDLPGRAVVLATGGLGGLYRATTNPAGALGSGLALAARAGAVLRDVE
FT                   FVQFHPTAIATGDAGPLPLATEALRGEGAILVNAAGERVMAGIAGAELAPRDVVARAIF
FT                   SRTSRGEAVFLDARRLDVARRFPTVAALCRKAGIDPAATPIPVSPAAHYHMGGIRVDGS
FT                   GRTSLPGLWACGEVASTGLHGANRLASNSLLEAMAFAAFIAADIRGLSSSAGRAAAEDA
FT                   PVPRPAALPEIRRIMEAEVGLVRNEAGLARAVARLGALAEAGSPEAAIGLLVAASALSR
FT                   RESRGAHWREDHPGQQEPRHAEITLAQARRLSASLAPLEVP"
     gtgagcgcgg accgcaccct cgtggtcggg gccggcgtgg ccggcctcgc cacggccctg        60
     cggctggcgc cgctcccggt cacgctgctg acgggcgccc cgcttggcga aggaacggcg       120
     accgcctggg cgcagggcgg catcgcggcg gcgatcggcc cggacgacga ccccgccctc       180
     cacgccgccg acacgcgggc ggccggcgcg ggcctgaccg atccggatgt cgcgcagcgg       240
     gtcgccgagg ccggtcccgg tctcgtcgcc tggctctccg cccttggcct tgccttcgac       300
     cgcgggccgg acggggcgct cgcgctcggc ctcgaagccg cgcatggccg ccgccgcatc       360
     gtgaaggcgg ggggcgacgc caccggccgg gcggtgctgc agaccctcgc ccgcgcgtcc       420
     gccgcgagcc cctcgatctc cgtcgtggtc gggcaggcga cggcgctggc gcaggatgcg       480
     aacggccgcg tcgcgggcct gcgcgcctgc gtgaacgggg cgagcgtcga tctcccgggg       540
     cgcgcggtcg tgctggcgac gggcggcctc ggcgggctct atcgcgccac caccaatccg       600
     gcgggcgcgc tcggctccgg ccttgcgctc gcggcgcggg ccggcgcggt gctgcgggac       660
     gtcgagttcg tgcagttcca tccgaccgcg atcgcgaccg gggatgccgg ccccctgccg       720
     ctggcgaccg aggccctgcg cggtgagggc gccatcctgg tgaacgcggc gggagagcgg       780
     gtgatggccg gcattgccgg ggccgagctc gcgccgcggg atgtcgtcgc ccgggcgatt       840
     ttctcccgga cgagccgcgg cgaggccgtc ttcctcgacg cgcgccgcct cgacgtcgcg       900
     cgccgcttcc cgaccgtggc ggccctctgc cgcaaggccg gaatcgatcc ggccgcgacg       960
     ccgatcccgg tgagccccgc cgcccattac cacatgggcg gcatccgggt ggatggaagc      1020
     ggacggacct ccctgcccgg cctgtgggcc tgcggcgagg tggcctcgac cgggctgcac      1080
     ggggcgaacc ggctcgccag caattcgctg ctcgaagcga tggccttcgc ggccttcatc      1140
     gcggcggaca tccggggcct gtcctccagt gccggccgcg ccgccgccga ggacgcgccg      1200
     gtgccccggc ccgccgccct gccggagatc cgccggatca tggaggccga ggtcgggctg      1260
     gtgcgcaatg aggccgggct ggcccgggcg gtcgcccgcc tcggcgccct tgcggaggcc      1320
     ggctcgcccg aagccgcaat cggcctcctc gtcgcggcct ccgccctgtc ccgccgcgag      1380
     agccgcggcg cccattggcg ggaagatcat ccggggcagc aggagccccg ccacgccgag      1440
     atcaccctgg cgcaggcgcg ccgcctctcc gcctcgcttg cccctctgga ggtcccatga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page