(data stored in ACNUC7421 zone)

EMBL: CP001349.PE164

CP001349.PE164       Location/Qualifiers
FT   CDS_pept        183690..184553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0170"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   met:M446_4589 nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55216"
FT                   /db_xref="GOA:B8I9G3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G3"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ACL55216.1"
FT                   /translation="MTDALPLSPLPRLLVEPIVRAALCEDLGRAGDLTTDSIVPAEARF
FT                   SGAIVARQTGVVAGTDAAALAFALLDPAVSVSVARPDGSAVAPGEAVITLDGPARAILS
FT                   AERVALNLLCRLSGIATATASLVEAARPHGRARIVCTRKTTPGLRTLEKHAVRAGGGSN
FT                   HRFGLDDAVLIKDNHLAVAGGVGPAIRRARAGVGHLVRIEVEVDTLAQLEEALALGADA
FT                   VLLDNMTPDELRRAVAMIDGRAISEASGRITRDSVGAVAASGVDLISTGWITHSAPIID
FT                   LGLDVA"
     atgaccgacg ctctccccct cagccccctg ccccgcctgc tcgtcgagcc gatcgtgcgg        60
     gcggcgctct gcgaagatct cggccgggcg ggcgatctca ccaccgacag catcgtcccg       120
     gccgaggccc ggttctccgg cgccatcgtc gcccgccaga ctggcgtggt cgcgggcacg       180
     gacgcggccg cgctcgcctt cgcgctcctc gaccctgcgg tgtcggtgtc ggtcgcgcgg       240
     ccggacggca gcgcggtcgc gcccggcgag gcggtgatca ccctcgacgg gccggcccgg       300
     gccatcctct ccgccgagcg ggtggcgctc aacctgctct gccggctctc gggcatcgcc       360
     accgccaccg cgtccctcgt cgaggccgcc cgcccgcacg ggcgcgcgcg catcgtctgc       420
     acgcgcaaga cgacgccggg tctgcggacc ctggagaagc atgcggtgcg ggccggcggc       480
     ggatcgaacc accgcttcgg cctcgacgat gcggtgctga tcaaggacaa ccatctggcg       540
     gtggcgggcg gcgtcggccc ggccatccgc cgtgcccgcg cgggcgtggg gcatctggtc       600
     aggatcgagg tggaggtcga taccctggcc cagctcgaag aggccctggc tttgggcgcc       660
     gatgcggtgc tcctcgacaa catgacgccc gacgagttgc gccgtgcggt cgcgatgatc       720
     gacgggcggg cgatcagcga ggcatcggga cggatcacgc gcgactcggt cggtgccgtc       780
     gcggcctcgg gggtggacct gatctccacg ggctggatca cgcacagcgc gccgatcatc       840
     gatctgggcc tcgacgtcgc ttaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page