(data stored in ACNUC7421 zone)

EMBL: CP001349.PE165

CP001349.PE165       Location/Qualifiers
FT   CDS_pept        complement(184629..185363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0171"
FT                   /product="protein of unknown function DUF1236"
FT                   /note="PFAM: protein of unknown function DUF1236; KEGG:
FT                   met:M446_4588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55217"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G4"
FT                   /inference="protein motif:PFAM:PF06823"
FT                   /protein_id="ACL55217.1"
FT                   /translation="MNKLVRGTLTASILVLGAATAFAQGGPGGGAGAGGGGAGGAGVGG
FT                   GAGGGAGGGGGAGAPGTGGGGGAGGARGAQGGPGGAGGATTGSERGTAQQPGGTAGRAG
FT                   EAPGRAGGTADQGTQRGGAERTGERGERGAERGEHRGERTERGERTGAISEARGASSRL
FT                   DTHQRTEFRQTIVKSGVRPMHGVNFSLSVGTAVPRSVTLHALPPTIVSLVPAYRGLRYV
FT                   LVDDEIVIIDPDTYEIVDVIRG"
     atgaacaagc tcgttcgtgg aaccttgact gccagtattc tggttcttgg cgccgcaacg        60
     gccttcgcgc aaggtggccc gggcggcggt gccggcgcag gcggcggcgg cgctggcggc       120
     gcgggtgtcg gcgggggagc cggcggcggc gccggtggtg gcgggggcgc cggcgccccc       180
     ggaacggggg gcggtggcgg agccggcggt gcgcgcgggg cgcagggcgg cccgggcggt       240
     gcgggcggcg ccaccacggg gagcgaacgc ggcacggcgc agcagccggg cggcactgcc       300
     ggccgggcgg gcgaggcgcc ggggcgcgca ggcggcacgg cggaccaggg cacccagcgc       360
     ggaggggccg agcgcacggg tgagcgcggc gagcgcggcg ccgaacgcgg cgagcacaga       420
     ggcgaacgca cggaacgcgg cgagcgcaca ggtgcgatca gcgaggcgcg cggcgcctcc       480
     tcgcgcctcg acacgcacca gcgcaccgag ttccgccaga ccatcgtgaa gtccggcgtc       540
     cggccgatgc acggggtcaa tttctcgctg tcggtgggca cggcggtgcc gcgctcggtg       600
     accctgcatg cgttgccgcc cacgatcgtc tcgctggtgc cggcctatcg cggcctgcgc       660
     tacgtgctgg tcgacgacga gatcgtcatc atcgatccgg acacctacga gatcgtcgac       720
     gtgatccgcg gctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page